.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pr7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein (NP_599989.1) from Corynebacterium glutamicum ATCC 13032 Kitasato at 1.44 A resolution. To be published
    Site JCSG
    PDB Id 2pr7 Target Id 370503
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS1571,NP_599989.1, 103357 Molecular Weight 14457.60 Da.
    Residues 136 Isoelectric Point 4.29
    Sequence mrglivdyagvldgtdedqrrwrnllaaakkngvgtvilsndpgglgaapireletngvvdkvllsgel gvekpeeaafqaaadaidlpmrdcvlvddsilnvrgaveaglvgvyyqqfdravveivglfglegef
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.44 Rfree 0.199
    Matthews' coefficent 2.50 Rfactor 0.168
    Waters 270 Solvent Content 50.76

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pr7
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    The gene cg0870 codifies a 136 amino acid long sequence (NP_599989) containing the C-terminal fragment of the 224 residues entry YP_001137745, which corresponds to the gene Cgl0761. It belongs to the HAD-like hydrolase group (PF00702) characterized by the conserved motif D7-A9 --//--D97-D98. The dimer crystal structure contains a Ca ion per molecule chelated by residues D7, A9, D98 plus three ordered water molecules. Analysis of its genome vicinity provides a hit to the uncharacterized protein NP_599990.

     

    SCOP classifies 2pr7 in the alpha/beta class, HAD-like superfamily, HAD-related family (?). The closest structural similarity detected is with 3cnh (FFAS scr=-54; Dali Z-scr=18). A second reliable hit (HHpred P-val=1e-29; FATCAT P-val=1e-6) is with 1zrn, a HAD from Pseudomonas sp. [Ref].

    Ligand Summary


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch