.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

Page Authors

 

T. maritima Browser

TOPSAN > Proteins > JCSG > 2ppv

2ppv

    Page last modified 23:54, 25 Oct 2010 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of uncharacterized protein (NP_764104.1) from Staphylococcus epidermidis ATCC 12228 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 2ppv Target Id 366230
    Molecular Characteristics
    Source Staphylococcus epidermidis atcc 12228
    Alias Ids TPS1474,NP_764104.1 Molecular Weight 36215.39 Da.
    Residues 331 Isoelectric Point 5.36
    Sequence mkqmnvvligggtglsvlarglrefpiditaivtvadnggstgkirdvmdipapgdirnviaalsdses iltqlfqyrfgenqvdghslgnlviagmtnitndfghaikelskvlnikgqvipstnasvqlnavmedg eivhgetnipkthkkidrvflepsdvepmneaiealeqadlivlgpgslytsvisnlcvkgiseallrt sapklyvsnvmtqpgetdnydvkehidaltrqvgepfidfvicssesyskdvlqryeeknskpvavhke qlkdsgirvltasnlveisnehyvrhntkvlskmiyelaleltstirftpsdkkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.212
    Matthews' coefficent 3.56 Rfactor 0.171
    Waters 281 Solvent Content 65.48

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The SE_0549 gene codifies for the NP_764104.1 uncharacterized protein that belongs to the UPF0052 group (PF01933) which includes the 2-phospho-L-lactate transferase CofD. Based on its genome vicinity, a significant hit (score 0.972) is obtained with NP_764103, a P-loop ATPase containing sequence, member of family PF03668.

     

    SCOP classifies 2ppv in the class alpha/beta, CofD-like superfamily, CofD-like family. The coordinates show the chelation of a phosphate ion by residues P243-F244-I245. The highest structural similarity (FFAS scr=-64; SSM 69%; Dali Z-scr=23; FATCAT P-val=4e-8) is observed with 3cgw, a phosphotransferase from Methanosarcina mazei [Ref]. A second reliable hit is with 2q7x.

    Ligand Summary



    References

    Reviews References Images Files Tags

    Reviews

    References

     

    1. Forouhar F, Abashidze M, Xu H, Grochowski LL, Seetharaman J, Hussain M, Kuzin A, Chen Y, Zhou W, Xiao R, Acton TB, Montelione GT, Galinier A, White RH, and Tong L Molecular insights into the biosynthesis of the F420 coenzyme. J Biol Chem. 2008 Apr 25; 283(17):11832-40 PubMed HubMed doi:10.1074/jbc.M710352200 pmid:18252724.

       


      Discuss this publication
    Add tag
    Tag page
    What links here
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch