.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ppv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein (NP_764104.1) from Staphylococcus epidermidis ATCC 12228 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 2ppv Target Id 366230
    Molecular Characteristics
    Source Staphylococcus epidermidis atcc 12228
    Alias Ids TPS1474,NP_764104.1, PF01933, 90520 Molecular Weight 36215.39 Da.
    Residues 331 Isoelectric Point 5.36
    Sequence mkqmnvvligggtglsvlarglrefpiditaivtvadnggstgkirdvmdipapgdirnviaalsdses iltqlfqyrfgenqvdghslgnlviagmtnitndfghaikelskvlnikgqvipstnasvqlnavmedg eivhgetnipkthkkidrvflepsdvepmneaiealeqadlivlgpgslytsvisnlcvkgiseallrt sapklyvsnvmtqpgetdnydvkehidaltrqvgepfidfvicssesyskdvlqryeeknskpvavhke qlkdsgirvltasnlveisnehyvrhntkvlskmiyelaleltstirftpsdkkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.212
    Matthews' coefficent 3.56 Rfactor 0.171
    Waters 281 Solvent Content 65.48

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ppv
    1. Molecular insights into the biosynthesis of the F420 coenzyme
    F Forouhar, M Abashidze, H Xu, LL Grochowski - Journal of Biological , 2008 - ASBMB
     

    Protein Summary

    The SE_0549 gene codifies for the NP_764104.1 uncharacterized protein that belongs to the UPF0052 group (PF01933) which includes the 2-phospho-L-lactate transferase CofD. Based on its genome vicinity, a significant hit (score 0.972) is obtained with NP_764103, a P-loop ATPase containing sequence, member of family PF03668.

     

    SCOP classifies 2ppv in the class alpha/beta, CofD-like superfamily, CofD-like family. The coordinates show the chelation of a phosphate ion by residues P243-F244-I245. The highest structural similarity (FFAS scr=-64; SSM 69%; Dali Z-scr=23; FATCAT P-val=4e-8) is observed with 3cgw, a phosphotransferase from Methanosarcina mazei [Ref]. A second reliable hit is with 2q7x.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch