.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pn2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein (YP_263861.1) from Psychrobacter arcticus 273-4 at 2.15 A resolution. To be published
    Site JCSG
    PDB Id 2pn2 Target Id 370504
    Molecular Characteristics
    Source Psychrobacter arcticus 273-4
    Alias Ids TPS1572,YP_263861.1, 103796 Molecular Weight 14896.18 Da.
    Residues 136 Isoelectric Point 5.73
    Sequence mttskvtyqgdlrtsaihlqsnneiitdapvdnqgkgeafsptdllatslascmltiigikardmeidi agttaevtkvmaadprrvsevhiaitfnqelddktqkifyntaltcpvaksihpdifqkviihsksy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.242
    Matthews' coefficent 2.01 Rfactor 0.195
    Waters 66 Solvent Content 38.69

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pn2
    1. Inhibition Mechanism of the Acetylcholine Receptor by _-Neurotoxins as Revealed by Normal-Mode Dynamics
    AO Samson, M Levitt - Biochemistry, 2008 - ACS Publications
     
    2. IN-SILICO PREDICTION OF STRUCTURAL AND FUNCTIONAL ASPECTS OF A HYPOTHETICAL PROTEIN OF CAPNOCYTOPHAGA CANIMORSUS CC5
    HH Pilley - Journal of Advanced Bioinformatics Applications and , 2011 - bipublication.com
     

    Protein Summary

    Gene Psyc_0566 from Psychrobacter arcticus translates into the YP_263861 amino acid sequence that belongs to the large family of OsmC-like proteins (PF02566, COG1765, and COG1764). Proteins from this family are present mostly in bacteria, but also in protists, slime molds and fungi and are involved in oxidative / osmotic stress response and hydroperoxide detoxification. Interestingly, eukaryotic proteins from this family do not form a common sub-tree and appear to represent independent gene transfer events.


    Other proteins from this family solved by JCSG are 
    Thermotoga maritima protein TM0919 (1vla) and Thermoplasma acidiophilumprotein NP_393673.1 (2onf). Structurally, 2pn2 and its homologs (PDB structures 2onf, 1ml8, 2d7v, 1n2f, 1qwi, and 2opl) belong to the OsmC-like fold from alpha+beta class, Ohr/OsmC resistance family. Cysteines Cys53 and Cys115 from Psychrobacter arcticus  protein align with functionally important cysteines from other members of this family, suggesting a possible location of an active site.
     

     
     
     

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch