The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of carbamoylphosphate synthase large subunit (split gene in MJ) (ZP_00538348.1) from Exiguobacterium sp. 255-15 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 2pn1 Target Id 369798
    Molecular Characteristics
    Source Exiguobacterium sibiricum 255-15
    Alias Ids TPS1551,YP_001815044.1, BV3936C, 91156 Molecular Weight 36840.30 Da.
    Residues 330 Isoelectric Point 4.90
    Sequence mqkphllitsagrraklveyfvkefktgrvstadcsplasalymadqhyivpkideveyidhlltlcqd egvtalltlidpelgllaqaterfqaigvtvivspyaacelcfdkytmyeyclrqgiahartyatmasf eealaagevqlpvfvkprngsasievrrvetveeveqlfskntdlivqellvgqelgvdayvdlisgkv tsifikekltmragetdksrsvlrddvfelvehvldgsglvgpldfdlfdvagtlylseinprfgggyp hayecgvnfpaqlyrnlmheinvpqigqylddiymlkhdtvtlisaaelqkikr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.239
    Matthews' coefficent 2.40 Rfactor 0.192
    Waters 165 Solvent Content 48.66

    Ligand Information


    Google Scholar output for 2pn1
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org

    Protein Summary

    Carbamoylphosphate synthase large subunit from Exiguobacterium sibiricum 255-15 contains ATP-grasp domain (PF02655).

    It has similar structure (DALI Z-scores between 12.4 and 21.4) to proteins with sequence identity to ZP_00538348 below 18% (i.e. PDB structures: 1ez1, 1kee, 1bnc, 1gso, 1b6r, 1iow, 1c3o, 1uc8, 2pbz,  1gsa,  1m6v, 1z2n,  1m6v, and 1auv).

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch