.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pg4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein (NP_147569.1) from Aeropyrum pernix at 2.21 A resolution. To be published
    Site JCSG
    PDB Id 2pg4 Target Id 373551
    Molecular Characteristics
    Source Aeropyrum pernix k1
    Alias Ids TPS1622,NP_147569.1, 91745 Molecular Weight 10757.07 Da.
    Residues 94 Isoelectric Point 8.97
    Sequence mddetlrlqfghlirilptllefekkgyepslaeivkasgvsektffmglkdrliraglvkeetlsyrv ktlkltekgrrlaeclekcrdvlgs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.21 Rfree 0.25754
    Matthews' coefficent 2.54 Rfactor 0.19797
    Waters 34 Solvent Content 51.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pg4
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The APE_0880a (APES039) gene from Aeropyrum pernix codes for the NP_147569.1 protein, a small polypeptide of 95 amino acids with a weak hit (e-val=0.01) with the winged helix DNA binding domain group (PF07381).

    SCOP classifies this protein in the all-alpha class, winged helix DNA-binding domain superfamily, F93-like family. DALI top hits are with the AF_1382 protein PDB:2qvo (Z=11) and the putative transcription factor PDB:3df8 (Z=11). It is suggested this protein is a dimeric bacterial transcription factor of unknown specificity. Taking the dimer gives a very good hit for PDB:1tbx, a viral winged helix DNA binding protein [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch