.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pg3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (YP_049261.1) from Erwinia carotovora subsp. atroseptica SCRI1043 at 2.40 A resolution. To be published
    Site JCSG
    PDB Id 2pg3 Target Id 371338
    Molecular Characteristics
    Source Erwinia carotovora subsp. atroseptica scri1043
    Alias Ids TPS1582,YP_049261.1, 91093 Molecular Weight 25361.41 Da.
    Residues 231 Isoelectric Point 5.33
    Sequence mkravvvfsggqdsttcliqalqdyddvhcitfdygqrhraeievaqelsqklgaaahkvldvgllnel atssltrdsipvpdydanaqgipntfvpgrnilfltlasiyayqvgaeavitgvcetdfsgypdcrdef vkalnqaivlgiardirfetplmwlnkaetwaladyyqqldtvryhtltcyngikgdgcgqcaachlra nglaqyqkdaatvmaslkqkvglr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.223
    Matthews' coefficent 2.32 Rfactor 0.186
    Waters 33 Solvent Content 46.98

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pg3
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Crystal structure of QueC from Bacillus subtilis: An enzyme involved in preQ1 biosynthesis
    N Cicmil, RH Huang - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     

    Protein Summary

    The queC (ECA1155) gene encodes the YP_049261.1 amino acid sequence that belongs to family PF06508 and corresponds to the queuosine biosynthesis enzyme queC, a pyrophosphatase that converts GTP in 7-cyano-7-deazaguanine (preQ0) in the purine metabolism [Ref]. Its gene appears in the vicinity and sometimes fused to YP_049127.1, a NADPH-dependent 7-cyano-7-deazaguanine reductase catalysing the next step in the queuosine synthesis (preQ0 -> preQ1).

     

    SCOP classifies 2pg3 in the alpha/beta class, adenine nucleotide alpha hydrolase-like superfamily, N-type ATP pyrophosphatase family. It presents high structural similarity (FFAS scr=-91; SSM 80%; Dali Z-scr=29.9) to 3bl5, the structure of the QueC enzyme from B. subtilis [Ref]

    Ligand Summary


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch