.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pfx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized peroxidase-related protein (YP_614459.1) from Silicibacter sp. TM1040 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 2pfx Target Id 369221
    Molecular Characteristics
    Source Silicibacter sp. tm1040
    Alias Ids TPS1545,YP_614459.1, 86088 Molecular Weight 21420.56 Da.
    Residues 190 Isoelectric Point 5.27
    Sequence mtkpkeptaldlpmadplpdetqkyfeicqeklgmvpnvlkayafnveklnaftamyndlmlgesqlsk leremiavvvssinkcfyclvahgaavrqlsgdpqlgemlvmnyrvapldarqrvmldfaakmtrasae ieeadrevlrshgfndrdiwdianvtgffnmtnrvasatammpnaeyhgqfr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.165
    Matthews' coefficent 2.49 Rfactor
    Waters 316 Solvent Content 50.67

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pfx
    1. Autoindexing with outlier rejection and identification of superimposed lattices
    NK Sauter, BK Poon - Journal of Applied Crystallography, 2010 - scripts.iucr.org
     
    2. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

    Gene TM1040_2465 from Silicibacter sp. codifies for the YP_614459 sequence that belongs to the CarboxyMuconolactone Decarboxylase, CMD, group (PF02627). It shows 90% identity with the alkylhydroperoxidase AhpD (ZP_05741951). It possesses the conserved sequence motif C85--C88---H92. Analysis of its genome vicinity provides a 0.79 scored hit with the peptidoglycan binding domain protein OmpA/MotB (YP_614458). 

     

    SCOP classifies 2pfx inside the all alpha class, AhpD-like superfamily, Atu0492-like family. It presents a high structural similarity (FFAS scr=-90; Dali Z-scr=27) with the putative peroxidases 2oyo, 2prr and 3c1l.  

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch