.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

Page Authors

 

T. maritima Browser

TOPSAN > Proteins > JCSG > 2pfw

2pfw

    Page last modified 00:35, 26 Oct 2010 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of Cupin 2 conserved barrel domain protein (YP_751781.1) from Shewanella frigidimarina NCIMB 400 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 2pfw Target Id 371790
    Molecular Characteristics
    Source Shewanella frigidimarina ncimb 400
    Alias Ids TPS1594,YP_751781.1 Molecular Weight 12669.59 Da.
    Residues 115 Isoelectric Point 5.02
    Sequence mqqsehfsfgeqteiediggglkrqmlgfnhelmavkiwfdkgaegyvhahrhsqvsyvvegefhvnvd gvikvltagdsffvpphvdhgavcptggilidtfsparedfvegls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.256
    Matthews' coefficent 3.04 Rfactor 0.189
    Waters 111 Solvent Content 59.47

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The Sfri_3105 gene encodes the YP_751781 amino acid sequence that belongs to the cupin 2 group (PF07883). Its genome context analysis provides two strong hits (score 0.950) with the Major Facilitator transporter (MFS 1) (YP_751782) and the poly beta-D-mannuronate lyase (YP_751779).

     

    SCOP classifies 2pfw in the all beta class, superfamily RmlC-like cupins, TM1287-like family. Closest similar structures are 1vj2, a manganese containing cupin[Ref], and 1v70. Both with scores: FFAS scr=-37; HHpred P-val=1e-25; Dali Z-scr=15; FATCAT P-val=2e-12. 

    Ligand Summary


    References

    Reviews References Images Files Tags

    Reviews

    References

     

    1. Jaroszewski L, Schwarzenbacher R, von Delft F, McMullan D, Brinen LS, Canaves JM, Dai X, Deacon AM, DiDonato M, Elsliger MA, Eshagi S, Floyd R, Godzik A, Grittini C, Grzechnik SK, Hampton E, Levin I, Karlak C, Klock HE, Koesema E, Kovarik JS, Kreusch A, Kuhn P, Lesley SA, McPhillips TM, Miller MD, Morse A, Moy K, Ouyang J, Page R, Quijano K, Reyes R, Rezezadeh F, Robb A, Sims E, Spraggon G, Stevens RC, van den Bedem H, Velasquez J, Vincent J, Wang X, West B, Wolf G, Xu Q, Hodgson KO, Wooley J, and Wilson IA Crystal structure of a novel manganese-containing cupin (TM1459) from Thermotoga maritima at 1.65 A resolution. Proteins. 2004 Aug 15; 56(3):611-4 PubMed HubMed doi:10.1002/prot.20130 pmid:15229893.

       


      Discuss this publication
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch