.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pfw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Cupin 2 conserved barrel domain protein (YP_751781.1) from Shewanella frigidimarina NCIMB 400 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 2pfw Target Id 371790
    Molecular Characteristics
    Source Shewanella frigidimarina ncimb 400
    Alias Ids TPS1594,YP_751781.1, 2.60.120.10, 92843 Molecular Weight 12669.59 Da.
    Residues 115 Isoelectric Point 5.02
    Sequence mqqsehfsfgeqteiediggglkrqmlgfnhelmavkiwfdkgaegyvhahrhsqvsyvvegefhvnvd gvikvltagdsffvpphvdhgavcptggilidtfsparedfvegls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.256
    Matthews' coefficent 3.04 Rfactor 0.189
    Waters 111 Solvent Content 59.47

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pfw
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

    The Sfri_3105 gene encodes the YP_751781 amino acid sequence that belongs to the cupin 2 group (PF07883). Its genome context analysis provides two strong hits (score 0.950) with the Major Facilitator transporter (MFS 1) (YP_751782) and the poly beta-D-mannuronate lyase (YP_751779).

     

    SCOP classifies 2pfw in the all beta class, superfamily RmlC-like cupins, TM1287-like family. Closest similar structures are 1vj2, a manganese containing cupin[Ref], and 1v70. Both with scores: FFAS scr=-37; HHpred P-val=1e-25; Dali Z-scr=15; FATCAT P-val=2e-12. 

    Ligand Summary


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch