.
The Open Protein Structure Annotation Network
PDB Keyword
.

2peb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative dioxygenase (ZP_00109509.1) from Nostoc punctiforme PCC 73102 at 1.46 A resolution. To be published
    Site JCSG
    PDB Id 2peb Target Id 374007
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS1625,NPUN_22DEC03_CONTIG1_REVISED_GENENPF1925, BIG_92 Molecular Weight 13694.81 Da.
    Residues 121 Isoelectric Point 5.22
    Sequence mkedtieiagfhahvyfdaasrdvaarvreglgarfevqlgrwfdkpigphpkgmyqvaflpnqfdkvv pwlmlnregldilvhpetgdavsdhavyslwlgeqldlnieflrqlsstssn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.46 Rfree 0.213
    Matthews' coefficent 2.08 Rfactor 0.185
    Waters 227 Solvent Content 41.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2peb
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Molecular structure of the photosynthetic apparatus
    YS DeRuyter, P Fromme - 2008 - books.google.com
     

    Protein Summary

    The Npun_F1925 gene from Nostoc punctiforme pcc 73102 codifies for a DOPA dioxygenase-like protein. The structure solved here corresponds to sequence YP_001865521 with the point mutations E103A, Q104A and D106A. It belongs to the DOPA 4,5-dioxygenase family (PF08883). In its genome vicinity, with a STRING score 0.766, sits a D-lactose dehydrogenase (NP_484102).

     

    SCOP classifies 2peb in the alpha+beta class, ferredoxin-like fold, DOPA-like superfamily, DOPA dioxygenase-like family. 2peb chelates a Zn ion per molecule via the conserved side chains of residues H12, H14, H84 and an unknown compound; it is highly similar in terms of tertiary structure to 2p8i (SSM 80%; Dali Z-scr=20) and 2nyh (SSM 80%; Dali Z-scr=19.6). 

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch