.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pc1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of acetyltransferase GNAT family (NP_688560.1) from Streptococcus agalactiae 2603 at 1.28 A resolution. To be published
    Site JCSG
    PDB Id 2pc1 Target Id 371586
    Molecular Characteristics
    Source Streptococcus agalactiae 2603v/r
    Alias Ids TPS1585,NP_688560.1 Molecular Weight 21057.72 Da.
    Residues 182 Isoelectric Point 5.35
    Sequence mqirlafpneidqimllieearaeiaktgsdqwqkedgypnrndiiddilngyawvgiedgmlatyaav idgheevydaiyegkwlhdnhryltfhriaisnqfrgrglaqtflqglieghkgpdfrcdtheknvtmq hilnklgyqycgkvpldgvrlayqkikekgetsiyreidernpm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.28 Rfree 0.178
    Matthews' coefficent 1.97 Rfactor 0.167
    Waters 179 Solvent Content 37.68

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene SAG1567 translates into the NP_688560.1 amino acid sequence that corresponds to a single domain protein with a low homology (e-val=6e-4) to the acetyltransfersase GNAT family (PF00583). It has a weak (score 0.66) genome context link with NP_688559, a 2-hydroxyacid dehydrogenase.

     

    2pc1 structure belongs to the SCOP alpha+beta class, Acyl-Coa N-acyltransferase superfamily, N-acetyltransferase family. The closest structure similarity is with 2fia (FFAS scr=-65; HHpred P-val=1e-34; SSM 77%; Dali Z-scr=20.1; FATCAT P-val=4e-14), 2oh1 (FFAS scr=-64; HHpred P-val=1e-33; Dali Z-scr=17.4) and 3bln (FFAS scr=-50; HHpred P-val=1e-30; SSM 85%; Dali Z-scr=17.8), all bacterial acetyltransferases.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch