| Title | Crystal structure of acetyltransferase GNAT family (NP_688560.1) from Streptococcus agalactiae 2603 at 1.28 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 371586 | | Molecular Characteristics | | Source | Streptococcus agalactiae 2603v/r | | Alias Ids | TPS1585,NP_688560.1 | Molecular Weight | 21057.72 Da. | | Residues | 182 | Isoelectric Point | 5.35 | | Sequence | mqirlafpneidqimllieearaeiaktgsdqwqkedgypnrndiiddilngyawvgiedgmlatyaav idgheevydaiyegkwlhdnhryltfhriaisnqfrgrglaqtflqglieghkgpdfrcdtheknvtmq hilnklgyqycgkvpldgvrlayqkikekgetsiyreidernpm | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.28 | Rfree | 0.178 | | Matthews' coefficent | 1.97 | Rfactor | 0.167 | | Waters | 179 | Solvent Content | 37.68 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
Gene SAG1567 translates into the NP_688560.1 amino acid sequence that corresponds to a single domain protein with a low homology (e-val=6e-4) to the acetyltransfersase GNAT family (PF00583). It has a weak (score 0.66) genome context link with NP_688559, a 2-hydroxyacid dehydrogenase.
2pc1 structure belongs to the SCOP alpha+beta class, Acyl-Coa N-acyltransferase superfamily, N-acetyltransferase family. The closest structure similarity is with 2fia (FFAS scr=-65; HHpred P-val=1e-34; SSM 77%; Dali Z-scr=20.1; FATCAT P-val=4e-14), 2oh1 (FFAS scr=-64; HHpred P-val=1e-33; Dali Z-scr=17.4) and 3bln (FFAS scr=-50; HHpred P-val=1e-30; SSM 85%; Dali Z-scr=17.8), all bacterial acetyltransferases.
Ligand Summary
References