.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pc1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of acetyltransferase GNAT family (NP_688560.1) from Streptococcus agalactiae 2603 at 1.28 A resolution. To be published
    Site JCSG
    PDB Id 2pc1 Target Id 371586
    Molecular Characteristics
    Source Streptococcus agalactiae 2603v/r
    Alias Ids TPS1585,NP_688560.1, BV1424C, 92851 Molecular Weight 21057.72 Da.
    Residues 182 Isoelectric Point 5.35
    Sequence mqirlafpneidqimllieearaeiaktgsdqwqkedgypnrndiiddilngyawvgiedgmlatyaav idgheevydaiyegkwlhdnhryltfhriaisnqfrgrglaqtflqglieghkgpdfrcdtheknvtmq hilnklgyqycgkvpldgvrlayqkikekgetsiyreidernpm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.28 Rfree 0.178
    Matthews' coefficent 1.97 Rfactor 0.167
    Waters 179 Solvent Content 37.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pc1
    1. Expansion of the protein repertoire in newly explored environments: human gut microbiome specific protein families
    K Ellrott, L Jaroszewski, W Li, JC Wooley - PLoS computational , 2010 - dx.plos.org
     
    2. Evolution of insect arylalkylamine N-acetyltransferases: Structural evidence from the yellow fever mosquito, Aedes aegypti
    Q Han, H Robinson, H Ding - Proceedings of the , 2012 - National Acad Sciences
     

    Protein Summary

    Gene SAG1567 translates into the NP_688560.1 amino acid sequence that corresponds to a single domain protein with a low homology (e-val=6e-4) to the acetyltransfersase GNAT family (PF00583). It has a weak (score 0.66) genome context link with NP_688559, a 2-hydroxyacid dehydrogenase.

     

    2pc1 structure belongs to the SCOP alpha+beta class, Acyl-Coa N-acyltransferase superfamily, N-acetyltransferase family. The closest structure similarity is with 2fia (FFAS scr=-65; HHpred P-val=1e-34; SSM 77%; Dali Z-scr=20.1; FATCAT P-val=4e-14), 2oh1 (FFAS scr=-64; HHpred P-val=1e-33; Dali Z-scr=17.4) and 3bln (FFAS scr=-50; HHpred P-val=1e-30; SSM 85%; Dali Z-scr=17.8), all bacterial acetyltransferases.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch