The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative thioesterase (YP_614486.1) from Silicibacter sp. TM1040 at 1.79 A resolution. To be published
    Site JCSG
    PDB Id 2pbl Target Id 371276
    Molecular Characteristics
    Source Silicibacter sp. tm1040
    Alias Ids TPS1578,YP_614486.1, 91766 Molecular Weight 28610.78 Da.
    Residues 261 Isoelectric Point 4.76
    Sequence melddayangayiegaadypprwaasaedfrnslqdrarlnlsygegdrhkfdlflpegtpvglfvfvh ggywmafdksswshlavgalskgwavampsyelcpevriseitqqisqavtaaakeidgpivlaghsag ghlvarmldpevlpeavgarirnvvpisplsdlrpllrtsmnekfkmdadaaiaespvemqnrydakvt vwvggaerpafldqaiwlveawdadhviafekhhfnviepladpesdlvavita
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.79 Rfree 0.27
    Matthews' coefficent 2.17 Rfactor 0.221
    Waters 1310 Solvent Content 43.40

    Ligand Information


    Google Scholar output for 2pbl
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
    2. FLORA: a novel method to predict protein function from structure in diverse superfamilies
    OC Redfern, BH Dessailly, TJ Dallman - PLoS computational , 2009 - dx.plos.org
    3. Collective motions in glucosamine-6-phosphate synthase: influence of ligand binding and role in ammonia channelling and opening of the fructose-6-phosphate
    N Floquet, P Durand, B Maigret, B Badet - Journal of Molecular , 2009 - Elsevier
    4. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
    5. Characterisation of the interaction of the C-terminus of the dopamine D2 receptor with neuronal calcium sensor-1
    LY Lian, SR Pandalaneni, P Patel, HV McCue - PloS one, 2011 - dx.plos.org
    6. The crystal structure of an esterase from the hyperthermophilic microorganism Pyrobaculum calidifontis VA1 explains its enantioselectivity
    GJ Palm, E Fernndez-lvaro, X Bogdanovi_ - Applied microbiology , 2011 - Springer
    7. Biochemical identification and crystal structure of kynurenine formamidase from Drosophila melanogaster
    H Qian, R Howard, L Jianyong - Biochemical Journal, 2012 - biochemj.org
    8. Exploiting Protein Structures to Predict Protein Functions
    A Cuff, O Redfern, B Dessailly, C Orengo - Protein Function Prediction for , 2011 - Springer

    Protein Summary

    The TM1040_2492 gene from Silicibacter sp. encodes the protein YP_614486.1, a putative esterase enzyme belonging to the alpha/beta hydrolase fold 3 (PFAM:PF07859). STRING genome context analysis indicates a link with the tryptophane-2,3-dioxygenase gene (YP_6142201.1). 


    SCOP classifies 2pbl in the alpha/beta class, alpha/beta hydrolases superfamily, carboxylesterase family (SUNID:53487. Closest structural similarity is observed with the carboxylesterases PDB:2c7b (FFAS scr=-55; HHpred P-val=1e-33; Dali Z-scr=23.5) and PDB:1jji (FFAS scr=-53; HHpred P-val=4e-35; Dali Z-scr=23.1).

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch