.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p97

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (YP_323572.1) from Anabaena variabilis ATCC 29413 at 1.65 A resolution. To be published
    Site JCSG
    PDB Id 2p97 Target Id 370290
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS1559,YP_323572.1, 103238, 103753 Molecular Weight 22319.37 Da.
    Residues 200 Isoelectric Point 5.45
    Sequence mkslhrpdlyswstfnparnidfngfawirpegnilidpvalsnhdwkhleslggvvwivltnsdhvrs akeiadqtytkiagpvaekenfpiycdrwlsdgdelvpglkvmelqgsktpgelallleettlitgdlv rayraggleilpdeklmnkqkvvasvrrlaalekveavlvgdgwsvfrdgrdrlkelvatla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.189
    Matthews' coefficent 2.86 Rfactor 0.16
    Waters 517 Solvent Content 56.99

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p97
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    The Ava_3068 gene from Anabaena variabilis translates into the YP_323572.1 amino acid sequence without a Pfam group yet defined. A Blast search provides a hit (e-val=1e-54; seq. id. 24%) with the beta lactamase domain containing protein ZP_06229560 from Burkholderia sp.

    SCOP classifies 2p97 in the alpha+beta class, metallo-hydrolase/oxidoreductase superfamily, Ava3068-like family. The highest structural similarity is with Zn-chelating beta-lactamases like PDB:1A7T (HHpred P-val=2e-32; Dali Z-scr=19.8), PDB:1DD6 (SSM 76%; Dali Z-scr=20.1), and PDB:1JJT (SSM 71%; FATCAT P-val=2e-9). 2p97 dimeric crystal structure contains 2 Mg ions chelated in equivalent positions by the side chains of residues D38-H66-D136-D180 of each monomer.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch