.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p8j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of S-adenosylmethionine-dependent methyltransferase (NP_349143.1) from Clostridium acetobutylicum at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 2p8j Target Id 372432
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS1609,NP_349143.1, BIG_646, 92615 Molecular Weight 24125.51 Da.
    Residues 208 Isoelectric Point 8.24
    Sequence mktiirqpqlyrflkycnesnldktvldcgaggdlpplsifvedgyktygieisdlqlkkaenfsrenn fklniskgdirklpfkdesmsfvysygtifhmrkndvkeaideikrvlkpgglacinflttkderynkg ekigegeflqlergekvihsyvsleeadkyfkdmkvlfkedrvverindglkikqgyvdyiaekfsksil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.201
    Matthews' coefficent 3.31 Rfactor 0.165
    Waters 318 Solvent Content 62.83

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p8j
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The CA_C2531 gene codifies for the NP_349143.1 protein that belongs to the S-adenosyl-L-methionine dependent Methyltransferase type 11 (PF08241). 

    SCOP classifies 2p8j in the alpha/beta class, SAM-dependent methyltransferase superfamily, CAC2371-like family.

    The closest structural similarity is with 1ve3 (FFAS score=-48; HHpred P-val=2e-32; SSM 76%; Dali Z-scr=19.5; FATCAT P-val=1.7e-10).

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch