.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p8i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative dioxygenase (YP_555069.1) from Burkholderia xenovorans LB400 at 1.40 A resolution. To be published
    Site JCSG
    PDB Id 2p8i Target Id 367834
    Related PDB Ids 2nyh 
    Molecular Characteristics
    Source Burkholderia xenovorans lb400
    Alias Ids TPS1527,YP_555069.1, BIG_92, 86345 Molecular Weight 13254.12 Da.
    Residues 116 Isoelectric Point 6.00
    Sequence mtfrdtsaiaswhahvyfdassrdaawtlreqieahwsgklqlgrfherpvgphpmwsyqlaftqeqfa dlvgwltlnhgaldiflhpntgdalrdhrdaavwighshelvlsaln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.40 Rfree 0.173
    Matthews' coefficent 2.47 Rfactor 0.144
    Waters 877 Solvent Content 50.15

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

     2p8i structure is the same sequence but different crystal form as in 2nyh coordinates. See 2nyh entry for functional details.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch