.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p8g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of phenolic acid decarboxylase (2635953) from Bacillus subtilis at 1.36 A resolution. To be published
    Site JCSG
    PDB Id 2p8g Target Id 370637
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS1574,2635953, PF05870 Molecular Weight 19075.63 Da.
    Residues 161 Isoelectric Point 5.04
    Sequence menfigshmiytyengweyeiyikndhtidyrihsgmvagrwvrdqevnivkltegvykvswteptgtd vslnfmpnekrmhgiiffpkwvhehpeitvcyqndhidlmkesrekyetypkyvvpefaeitflknegv dneeviskapyegmtddiragrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.36 Rfree 0.146
    Matthews' coefficent 3.46 Rfactor 0.133
    Waters 254 Solvent Content 64.44

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p8g
    1. p_Coumaric acid decarboxylase from Lactobacillus plantarum: Structural insights into the active site and decarboxylation catalytic mechanism
    H Rodrguez, I Angulo, B de las Rivas - Proteins: Structure, , 2010 - Wiley Online Library
     
    2. Structural basis of enzymatic activity for the ferulic acid decarboxylase (FADase) from Enterobacter sp. Px6-4
    W Gu, J Yang, Z Lou, L Liang, Y Sun, J Huang, X Li - PloS one, 2011 - dx.plos.org
     
    3. Structural analysis of Bacillus pumilus phenolic acid decarboxylase, a lipocalin-fold enzyme
    A Matte, S Grosse, H Bergeron, K Abokitse - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Mutational analysis of phenolic acid decarboxylase from Bacillus subtilis (BsPAD), which converts bio-derived phenolic acids to styrene derivatives
    A Frank, W Eborall, R Hyde, S Hart - Catalysis Science & , 2012 - pubs.rsc.org
     

    Protein Summary

    The padC (yveH) (BSU34400) gene from B. subtilis encodes the protein NP_391320 which is a phenolic acid decarboxylase (PAD) [Ref]. Its amino acid sequence belongs to the family PF05870 and the structure solved here is the K146Y mutant.

     

    SCOP classifies 2p8g inside the all-beta class, lipocalins superfamily, PAD family. The bacterial PAD structures 2gc9, and its related entry 2w2a, scored the highest similarity with 2p8g (FFAS score=-107; SSM 86%; Dali Z-scr=29). 

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch