.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p2s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative oxidoreductase (YP_050235.1) from Erwinia carotovora atroseptica SCRI1043 at 1.25 A resolution. To be Published
    Site JCSG
    PDB Id 2p2s Target Id 369785
    Molecular Characteristics
    Source Erwinia carotovora subsp. atroseptica scri1043
    Alias Ids TPS1550,YP_050235.1, 283373 Molecular Weight 37369.16 Da.
    Residues 335 Isoelectric Point 5.64
    Sequence mkkirfaaiglahnhiydmcqqlidagaelagvfesdsdnrakftslfpsvpfaasaeqlitdasidli acavipcdraelalrtldagkdfftakpplttleqldavqrrvaetgrkfavyfnerinvdsalfagel vqrgeigrviqtmgvgphrergarpdwfyqkrqyggilcdigihqieqflyftgntnarvvtsqtanyh hphhpefedfgdamllgdngatgyfrcdwftpdglsvwgdgrltilgtegyieirkyvdltrgesnvvy lvngkgeqrftpagsveraffpdflrdcrertenamsqshifkatelsilaqqaankia
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.25 Rfree 0.179
    Matthews' coefficent 2.25 Rfactor 0.156
    Waters 857 Solvent Content 45.34

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The ECA2140 gene encodes the YP_050235.1 protein, a putative oxidoreductase containing the two regions commonly observed for this enzyme: NAD-binding Rossmann fold at the N-terminus (PF01408) and a C-terminal a+b domain (PF02894). Based on genome context, STRING provides a 0.72 scored hit with a different putative oxidoreductase, YP_050302.

     

    SCOP classifies the N-terminal domain inside the alpha/beta class, NAD-binding superfamily, glyceraldehyde-3-phosphate dehydrogenase-like N-terminal domain family; the C-terminal region belongs to the alpha+beta class, glyceraldehyde-3-phosphate dehydrogenase-like C-terminal domain superfamily, glucose-6-phosphate dehydrogenase-like family. Top hits from FFAS (score -80), HHpred, SSM (94%) and Dali (Z-scr=32.1) are 2glx (a NADP-dependent 1,5-anhydro-D-fructose reductase) and 3db2. Reliably identified by HHpred and FATCAT is 1zh8.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch