.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p1a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_978475.1) from Bacillus cereus ATCC 10987 at 2.10 A resolution. To be published
    Site JCSG
    PDB Id 2p1a Target Id 366831
    Molecular Characteristics
    Source Bacillus cereus atcc 10987
    Alias Ids TPS1478,NP_978475.1, 86121 Molecular Weight 17951.87 Da.
    Residues 153 Isoelectric Point 5.95
    Sequence mfvqsalhqlkvavdtsiqmldqyteidlkiapiqskrslfemyahlslichadllilngstekelhtf ykeqtpetiaqmqktmiqgydllsktflsysneqlaemktaywgisysrfewlleivahfyhhrgqihi llcehmkdpniplfq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.268
    Matthews' coefficent 2.10 Rfactor 0.221
    Waters 98 Solvent Content 41.35

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p1a
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Image-based crystal detection: a machine-learning approach
    R Liu, Y Freund, G Spraggon - Acta Crystallographica Section D: , 2008 - scripts.iucr.org
     
    3. The structure of DinB from Geobacillus stearothermophilus: a representative of a unique four-helix-bundle superfamily
    DR Cooper, K Grelewska, CY Kim - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Clonacin y caracterizacin de genes efectores de especies patognicas del gnero Phytophthora que atacan cultivos de la familia solanaceae en los Andes del
    VD Armijos Jaramillo - 2007 - repositorio.espe.edu.ec
     

    Protein Summary

    The gene BCE_2162 from Bacillus cereus atcc 10987 encodes the NP_978475 amino acid sequence that belongs to the DinB superfamily (PF05163).

    SCOP classifies 2p1a in the all alpha class, DinB/YfiT-like putative metalloenzymes superfamily.

    Dali top hits for 2p1a are with 2hkv (Z-scr=18) and the YfiT-like protein 1rxq [Ref] (Z-scr=14).

    2p1a contains the characteristic triad of histidines that usually coordinate a nickel ion.  In particular the two histidines that are part of the C-terminal alpha helix contain the HXYHHR sequence motif that is also found in the 2hkv structure. So these two structures may share a common function.


     

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch