.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p11

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (YP_553970.1) from Burkholderia xenovorans LB400 at 2.20 A resolution. To be published
    Site JCSG
    PDB Id 2p11 Target Id 366852
    Molecular Characteristics
    Source Burkholderia xenovorans lb400
    Alias Ids TPS1479,YP_553970.1, 86139 Molecular Weight 26483.00 Da.
    Residues 230 Isoelectric Point 5.75
    Sequence mqattatphdivflfdcdntlldndhvladlrahmmrefgaqnsaryweifetlrtelgyadylgalqr yrleqprdtrlllmssflidypfasrvypgalnalrhlgargptvilsdgdvvfqprkiarsglwdeve grvliyihkelmldqvmecyparhyvmvddklrilaamkkawgarlttvfprqghyafdpkeisshppa dvtverigdlvemdaewllaekr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.247
    Matthews' coefficent 2.07 Rfactor 0.201
    Waters 104 Solvent Content 40.55

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p11
    1. Enhanced detection of clinically relevant genomic imbalances using a targeted plus whole genome oligonucleotide microarray
    EL Baldwin, JY Lee, DM Blake, BP Bunke - Genetics in , 2008 - nature.com
     
    2. Pax5 haploinsufficiency cooperates with BCR-ABL1 to induce acute lymphoblastic leukemia
    CB Miller - 2009 - etd.uthsc.edu
     
    3. Identification of a novel CRYBB2 missense mutation causing congenital autosomal dominant cataract
    N Weisschuh, S Aisenbrey, B Wissinger - Molecular Vision, 2012 - ncbi.nlm.nih.gov
     
    4. IMGT, the international ImMunoGeneTics information system, the reference in immunogenetics and immunoinformatics
    P Duroux, V Giudicelli, Q Kaas - Proceedings of the first , 2007 - imgt.org
     
    5. ATM gene alterations in chronic lymphocytic leukemia patients induce a distinct gene expression profile and predict disease progression
    A Guarini, M Marinelli, S Tavolaro, E Bellacchio - , 2011 - haematologica.com
     
    6. Clonacin y caracterizacin de genes efectores de especies patognicas del gnero Phytophthora que atacan cultivos de la familia solanaceae en los Andes del
    VD Armijos Jaramillo - 2007 - repositorio.espe.edu.ec
     

    Protein Summary

    Gene Bxeno_B1652 (Bxe_B1342) translates into the YP_553970.1 protein, a putative HAloacid Dehalogenase-like (HAD) hydrolase whose primary sequence belongs to the PF00702. It is characterized by the presence of an alpha-helical subdomain at the N-terminus. 

     

    2p11 structure classifies into the SCOP alpha/beta protein class, HAD-like superfamily, beta-phosphoglucomutase-like family. Top hits with FFAS (score -61; -59), HHpred (P-val=6e-36; 6e-32) and Dali (Z-scr=17.2) are with 3ed5 and 3ddh, both putative HAD-like enzymes.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch