.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p10

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_085906.1) from Mesorhizobium loti at 2.15 A resolution. To be published
    Site JCSG
    PDB Id 2p10 Target Id 368116
    Molecular Characteristics
    Source Mesorhizobium loti maff303099
    Alias Ids TPS1534,NP_085906.1, BIG_443, BIG_293, 86207 Molecular Weight 30536.26 Da.
    Residues 285 Isoelectric Point 5.34
    Sequence mstdtcikrptrselvdrfqkkiragepiigggagtglsakseeagdidliviynsgryrmagrgslag llaygnanqivvdmarevlpvvrhtpvlagvngtdpfmvmstflrelkeigfagvqnfptvglidglfr qnleetgmsyaqevemiaeahkldllttpyvfspedavamakagadilvchmglttggaigarsgksmd dcvslinecieaartirddiiilshggpianpedarfildscqgchgfygassmerlpaeeairsqtla fkairrqpa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.15 Rfree 0.204
    Matthews' coefficent 3.10 Rfactor 0.162
    Waters 712 Solvent Content 60.36

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p10
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. SOME PROPERTIES OF CRYSTALLOGRAPHIC RELIABILITY INDEX-Rfactor: EFFECT OF TWINNING
    GN MURSHUDOV - Appl. Comput. Math, 2011 - elm.az
     
    3. Clonacin y caracterizacin de genes efectores de especies patognicas del gnero Phytophthora que atacan cultivos de la familia solanaceae en los Andes del
    VD Armijos Jaramillo - 2007 - repositorio.espe.edu.ec
     

    Protein Summary

    The gene mll9387 from M. loti translates into the NP_085906.1 amino acid sequence which folds as a single domain protein belonging to the TIM barrel signal transduction family (PF09370) observed in more than 187 aas sequences of organisms from all three kingdoms. From its genome context analysis, STRING provides a 0.987 scored hit with the UPF0261 (PF06792). Sometimes both proteins appear fused as part of the same gene. 

     

    SCOP classifies 2p10 in the alpha/beta TIM barrel class, superfamily phosphoenolpyruvate/pyruvate, family Mll9387-like. Significant structural similarity is found with 2hjp, a phosphonopyruvate hydrolase (HHpred P-val=2.5e-33; Dali Z-scr=19.1; SSM=70%), and with the phosphoenolpyruvate mutase 1s2w (HHpred P-val=3.1e-33; FATCAT=4.6e-11).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch