.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ozh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_638301.1) from Xanthomonas campestris at 1.40 A resolution. To be published
    Site JCSG
    PDB Id 2ozh Target Id 371737
    Molecular Characteristics
    Source Xanthomonas campestris pv. campestris str. atcc 33913
    Alias Ids TPS1593,NP_638301.1, 91816 Molecular Weight 15711.06 Da.
    Residues 141 Isoelectric Point 6.35
    Sequence mphvhvstdnslldiglihrtlsqdtdwakdiplalvqraidhslcfggfvdgrqvafarvisdyatfa ylgdvfvlpehrgrgyskalmdavmahpdlqglrrfslatsdahglyarygftpplfpqslmeryvpgl yst
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.155
    Matthews' coefficent 2.76 Rfactor 0.143
    Waters 249 Solvent Content 55.48

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene XCC2953 (PF00583, cl00443) from Xanthomonas campestris encodes a putative acetyltransferase from the GNAT family. Its genomic neighborhood includes a link (score 0.65) with the acetylornithine deacetylase argE.

    Pre-SCOP classifies 2ozh in the alpha+beta class, Acyl-CoA N-acyltransferases superfamily, NAT family. Top DALI hits for 2ozh are with the SA2161 protein 1y7r (Z=14), the YPEA protein 2pdo (Z=13), and the putative acetylglutamate synthetase 2r98 (Z=13).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch