.
The Open Protein Structure Annotation Network
PDB Keyword
.

2owp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein Bxe_B1374 (YP_553940.1) from Burkholderia xenovorans LB400 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 2owp Target Id 372960
    Molecular Characteristics
    Source Burkholderia xenovorans lb400
    Alias Ids TPS1614,YP_553940.1, 3.10.450.50, BIG_414, 92611 Molecular Weight 14364.60 Da.
    Residues 128 Isoelectric Point 5.51
    Sequence mevnqpdivaqvqaafveyeralvendieamnalfwhtpetvrygiaevqhggeairawrercepvpks rklhrtvvttfgtdfatvsteftsdatpllgrqmqtwarlspadgwkivaahvsliamp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.236
    Matthews' coefficent 3.72 Rfactor 0.192
    Waters 297 Solvent Content 66.91

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene Bxe_B1374 from Burkholderia xenovorans LB400 encodes the YP_553940 protein, a member of the DUF3225 group (PF11533) form by a large family of uncharacterized bacterial proteins, with distant homology to eukaryotic calcium/calmodulin dependent kinase association domain. Even more distant bacterial homologs of Bxe_B1374 are enzymes with delta steroid isomerase activity. According to a BLAST search, the annotated protein with the highest identity to Bxe_B1374 is the imidazolonepropionase ZP_04605990 (e-val=7e-45; seq.id. 50%).

    2owp has a cystatin-like fold, with three helices packed against a strongly twisted antiparallel beta sheet.

    It belongs to the SCOP NTF2-like superfamily, ketosteroid isomerase-like family.

    2owp most similar structure is PDB:2rcd detected by Dali with Z-score of 22.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch