.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ou6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_294789.1) from Deinococcus radiodurans at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 2ou6 Target Id 370329
    Molecular Characteristics
    Source Deinococcus radiodurans r1
    Alias Ids TPS1561,NP_294789.1, PF04978, 91359 Molecular Weight 20863.32 Da.
    Residues 189 Isoelectric Point 4.74
    Sequence mptfnpelhaqtlnserayfvqpdadpaftphigalvemltyarlttlqaveglpedqlwatapgfans igtllahiaavervyhvlsfqgrdvtpeddgaaywgltmgkegtaparlptldelraeladaraetlrv faakddawlaeplgpgwanqhwawfhvmedevnhrgqlrllrqvlapeegg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.188
    Matthews' coefficent 2.87 Rfactor 0.155
    Waters 266 Solvent Content 57.19

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ou6
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    3. The structure of DinB from Geobacillus stearothermophilus: a representative of a unique four-helix-bundle superfamily
    DR Cooper, K Grelewska, CY Kim - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    Gene DR_1065 from Deinococcus radiodurans encodes the NP_294789 protein that belongs to the DinB clan, DUF664 family (PF04978). SCOP classifies 2ou6 in the all alpha class, DinB/YfiT-like putative metalloenzymes, DinB-like family. Dali top hits for 2ou6 are with 2qnl (Z-scr=14), 2p1a (Z-scr=13) and the YfiT protein 1rxq (Z-scr=13).

     

    2ou6 coordinates a nickel ion using a triad of residues: H76, D168 and H172. However unlike most members of the superfamily that use three histidines this protein has an aspartate replacing the second histidine. The superfamily contains many members that have an aspartate or glutamate at this position and based on this structure we would expect that these are functional homologues rather than inactivated relatives.
     

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch