.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ou5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of pyridoxamine 5'-phosphate oxidase-related FMN-binding (YP_508196.1) from Jannaschia sp. CCS1 at 1.60 A resolution. To be published
    Site JCSG
    PDB Id 2ou5 Target Id 370379
    Molecular Characteristics
    Source Jannaschia sp. ccs1
    Alias Ids TPS1562,YP_508196.1 Molecular Weight 19178.90 Da.
    Residues 174 Isoelectric Point 9.35
    Sequence msdtvltglldtvwqqfgrgtkdrhhparhptlatigtdgpdlrtlvlraashaeatlefhtdaaspkv ahirrdarvaihiwipkaslqvrakaiakilpgdpnlfaqlpeaarmnyqgpvpgtplpaepdatpnrf trlichlseidvlhlttphqravytapdwrgiwvsp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.221
    Matthews' coefficent 2.27 Rfactor 0.178
    Waters 413 Solvent Content 45.80

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The Jann_0254 gene encodes the YP_508196.1 amino acid sequence that folds into a 174 residues long polypeptide containing a Pyridoxamine 5'-phosphate Oxidase like domain (PNPOx) between residues 30 to 100. This class of enzymes (PF01243) catalyzes the conversion of pyridoxamine-5-phosphate to pyridoxal-5-phosphate using flavin mono-nucleotide (FMN) as cofactor. This dimeric crystal structure, 2os5, presents 2 FMN molecules, each interacting with three regions of the protein around residues: R44-T45-V47; H61-T62-K68; Q90-R92. Based on the genome context where the gene codifying this protein is located, a predicted functional partner is YP_508198.

     

    SCOP classifies 2os5 as an all beta structure in the superfamily FMN-binding split barrel, family PNPOx-like. Structural comparison searches provide the PNPOx-like structures PDB:1ci0, PDB:1t9m, PDB:1dnl as the most similar (Dali Z=15).

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch