.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ou3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Tellurite resistance protein of COG3793 (ZP_00109916.1) from Nostoc punctiforme PCC 73102 at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 2ou3 Target Id 373118
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS1618,NPUN_22DEC03_CONTIG1_REVISED_GENENPF6341, PF07049 Molecular Weight 18150.76 Da.
    Residues 160 Isoelectric Point 4.75
    Sequence msdikklgsswiinwffgfnqiptnedssiymksvltcakadgvispeekdwalgfcaswgvadwvied lktyeadealeeviarspqvsmaqrdillsaiwvsaadgelhekekakirkmatilgikeeivdqleql qqeeaalrqkrlnllypqkspy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.213
    Matthews' coefficent 2.22 Rfactor 0.161
    Waters 395 Solvent Content 44.66

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ou3
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    The gene Npun_F6341 translates into the amino acid sequence YP_001869556 corresponding to a hypothetical protein that belongs to the Tellurite resistance protein B-like group (PF05099), with more than 650 bacterial representatives with the same domain architecture. Its HMM profile shows a highly conserved sequence pattern: D37-E44--D110-E117. The structure solved here, 2ou3, shows a Zn ion chelated by the equivalent residues: D42-E49--D107-E114.

    SCOP classifies 2ou3 as belonging to the all-alpha class, TerB-like superfamily, COG3793-like family. HHpred and FFAS provide hits with the TerB-like proteins 2jxu (Pval=2.1e-23; score=-36.8) and 2h5n (Pval=1.6e-9; score=-15.2). Structural comparison servers consistently selected 2h5n as top hit: SSM sse=63%; Dali Z-scr=7.6; FATCAT P-val=6.5e-6.

    For a recent overview on tellurium oxianions and associated bacterial resistance, including tellurite (TeO32-), see [Ref].

    Ligand Summary


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch