.
The Open Protein Structure Annotation Network
PDB Keyword
.

2otm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_717567.1) from Shewanella oneidensis at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 2otm Target Id 371708
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS1591,NP_717567.1, 92850 Molecular Weight 16719.40 Da.
    Residues 153 Isoelectric Point 5.30
    Sequence mmntpesrlvaaglelpevaaalgnyepysivgsqlmtsgqfpylqgkllyqgqlgadytvsegyaacr latlnaiaqlkqacgelsrikqiyrlegvlnvhqsciehpkaldgasdllleifgeagrhsrmiwtnpv mplnslclvylfael
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.85 Rfree 0.177
    Matthews' coefficent 2.71 Rfactor 0.151
    Waters 427 Solvent Content 54.62

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2otm
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    Gene SO_1960 from Shewanella oneidensis encodes the NP_717567 protein, a putative endoribonuclease (45% seq. id. with YP_003302408). Its sequence similarity to proteins from COG0251 (putative translation initiation inhibitor from yjgF family) and very weak (e-val=0.0082) to PF01042 (endoribonuclease L-PSP) indicates that this protein may function as an endoribonuclease acting on single-stranded mRNA that inhibits protein synthesis by mRNA cleavage.

    SCOP classifies 2otm in the alpha+beta class, YjgF-like superfamily, YjgF/L-PSP family.

    According to DALI, 2otm shows structural similarity to a protein with unknown function PDB:3d01 (Z=24),  the TDCF protein PDB:2uyn (Z=13),  and to the YjgF proteins PDB:1qu9 (Z=13) and PDB:1pf5 (Z=10).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch