.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oso

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein MJ_1460 (1592102) from Methanocaldococcus jannaschii at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 2oso Target Id 373077
    Related PDB Ids 2osd 
    Molecular Characteristics
    Source Methanocaldococcus jannaschii dsm 2661
    Alias Ids TPS1928,1592102, BIG_84, PF02830 Molecular Weight 18782.10 Da.
    Residues 162 Isoelectric Point 5.07
    Sequence mafmekifpdileairneeiikeskkipmpyfglfalvifdkvkelgsetslyeigeefgkmlspknie elkkifklmnfgdleidenkillknppykiklsnppyqwvskeepihdfiagilagcleeifkkkfvvn evecvsqgkdkcvfevkevdelnk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.245
    Matthews' coefficent 2.30 Rfactor 0.189
    Waters 81 Solvent Content 46.42

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2oso
    1. The prokaryotic V4R domain is the likely ancestor of a key component of the eukaryotic vesicle transport system
    M Podar, MA Wall, KS Makarova, EV Koonin - Biol Direct, 2008 - biomedcentral.com
     
    2. 2. HEMOSTASIS
    BL Henry, UR Desai - cancer, 2010 - Wiley Online Library
     
    3. Three Dimensional Model for N-Terminal A Domain of DmpR (2-Dimethylphenol) Protein Based on Secondary Structure Prediction and Fold Recognition
    PS Suresh, R Kumar, A Kumar - In Silico Biology, 2010 - IOS Press
     

    Protein Summary

    Methanococcus jannaschii MJ_1460 gene is the first structurally characterized representative of the V4R (PF02830) protein family, predicted to bind small molecules, possibly hydrocarbons. Many proteins from this family contain an additional helix-loop-helix DNA binding domains and act as repressors/regulators.

    MJ_1460 protein is distantly related (and structurally similar) to Heme NO binding protein from Nostoc np., a founding member of PFAM HNOB family (PF07700). More detailed information available at related entry 2OSD.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Files (1)

    FileSizeDateAttached by 
    2osd.png
    No description
    22.49 kB19:21, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch