The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (YP_295660.1) from Ralstonia eutropha JMP134 at 2.10 A resolution. To be published
    Site JCSG
    PDB Id 2opk Target Id 371797
    Molecular Characteristics
    Source Ralstonia eutropha jmp134
    Alias Ids TPS1595,YP_295660.1,, 92849 Molecular Weight 12197.14 Da.
    Residues 111 Isoelectric Point 5.00
    Sequence mdpkhgnlfadvpvgapdeifqpllerkglkieriisngqasppgfwydspqdewvmvvsgsagieceg dtaprvmrpgdwlhvpahcrhrvawtdggeptvwlavhcdaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.207
    Matthews' coefficent 2.86 Rfactor 0.166
    Waters 462 Solvent Content 56.97

    Ligand Information


    Google Scholar output for 2opk
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
    2. Statistics of catalytic domain sequences in protein kinases vs non-kinases
    RR Joshi, C Manda - Protein and Peptide Letters, 2007 - ingentaconnect.com

    Protein Summary

    The Reut_A1446 gene from Ralstonia eutropha encodes the YP_295660 protein, a putative cupin domain PF07883.  The protein belongs to the class of all beta proteins, and reveals double-stranded beta-helix fold type SCOP51181.  The cupin domain is found in one or two copies in   proteins   whose  functions  vary  from  isomerase  and  epimerase activities involved   in  the  modification  of  cell  wall  carbohydrates  in bacteria, to  non-enzymatic storage proteins in plant seeds, and transcription factors linked  to  congenital  baldness  in mammals.  Many cupin-like domains structures have been solved for different organisms: 1Y3T, Bacillus subtilis; 2FQPBordetella pertussis.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch