.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ooj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_717203.1) from Shewanella oneidensis at 1.84 A resolution. To be published
    Site JCSG
    PDB Id 2ooj Target Id 372361
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS1606,NP_717203.1, BIG_478, 92494 Molecular Weight 15034.34 Da.
    Residues 140 Isoelectric Point 5.13
    Sequence memtkvtgkfdvkltpenayatgvggvnlgrmaldktfygelearsqgemlsamtavkgsagyvaieqv vgklcgrqgsfvlqhfgimtdgqnrlhlevvphsgageltglygtmaisiengqhfyefsfcfepasev eg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.84 Rfree 0.206
    Matthews' coefficent 2.24 Rfactor 0.178
    Waters 195 Solvent Content 45.11

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ooj
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. A model of dirigent proteins derived from structural and functional similarities with allene oxide cyclase and lipocalins
    B Pickel, J Pfannstiel, A Steudle, A Lehmann - FEBS , 2012 - Wiley Online Library
     

    Protein Summary

    The SO_1590 gene from  Shewanella oneidensis encodes the NP_717203 protein belonging to the DUF3224 group (PF11528).

    2ooj structure belongs to the all beta class, AOC barrel-like fold  (SCOP141492).  DALI top hits are with the uncharacterized protein 2q03 (Z=16),  and the allene oxide cyclase-2 2dio (Z=10; 14% seq.id.; rmsd 3.0 for 118 Ca aligned).

    A visual inspection of associated structures suggests structural affiliation with spreptavidin-like and lipocalin-like proteins 2WWP (human lipocalin).  There is another class of proteins sharing similar fold type, rhizavidin-like proteins 3EW2.  Rhizavidin protein maintains a homodimeric biological unit, which is also the case of given protein.  Thus, SO_1590 is possibly a rhizavidin-like protein.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch