.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ooc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of histidine phosphotransfer protein ShpA, an essential regulator of stalk biogenesis in Caulobacter crescentus. J.Mol.Biol. 390 686-698 2009
    Site JCSG
    PDB Id 2ooc Target Id 369423
    Molecular Characteristics
    Source Caulobacter crescentus cb15
    Alias Ids TPS1546,NP_419930.1, 3.10.450.50 Molecular Weight 11914.78 Da.
    Residues 112 Isoelectric Point 4.78
    Sequence marrdisgavdfaylegfaagdfavvdevlalfreqaalwapmldpthpgwkdavhtvkgaargvgafn lgevcerceagqeslegvrtaldaalldiaayaheqalrslkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.52 Rfree 0.202
    Matthews' coefficent 2.69 Rfactor 0.166
    Waters 219 Solvent Content 54.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ooc
    1. Crystal Structure of Histidine Phosphotransfer Protein ShpA, an Essential Regulator of Stalk Biogenesis in Caulobacter crescentus
    Q Xu, D Carlton, MD Miller, MA Elsliger - Journal of molecular , 2009 - Elsevier
     
    2. Probing dynamic conformations of the high molecular weight _B-crystallin heat shock protein ensemble by NMR spectroscopy
    AJ Baldwin, P Walsh, DF Hansen - Journal of the , 2012 - ACS Publications
     

    Protein Summary

    ShpA is a  histidine phosphotransfer protein. It is a component of a multiple stage two-component  signal transduction  system which relay phosphoryl group from His-Asp-His-Asp. The pathway is involved in regulating stalk biogenesis in Caulobacter crescentus.

    The active site is at His56. The structure is similar to yeast HPt YPD1 and a few recently solved HPt proteins.


    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch