.
The Open Protein Structure Annotation Network
PDB Keyword
.

2onf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_393673.1) from Thermoplasma acidophilum at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 2onf Target Id 370499
    Molecular Characteristics
    Source Thermoplasma acidophilum dsm 1728
    Alias Ids TPS1569,NP_393673.1, 92422 Molecular Weight 16012.35 Da.
    Residues 139 Isoelectric Point 5.22
    Sequence mhvyesdvswiddrrtevsvgdhrievdsppefggpegqlypetlfpsvlascllttflefkdrmginl kswnshvtaelgpspekgfkfhrikihvkigvndedkekipramqlaekycfisrairnnveeivdyefv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.201
    Matthews' coefficent 2.39 Rfactor 0.162
    Waters 306 Solvent Content 48.58

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene Ta0195 from Thermoplasma acidophilum encodes protein NP_393673 that belongs to the large family of OsmC-like proteins (PF02566, COG1765, and COG1764). Proteins from this family are present mostly in bacteria, but also in protists, slime molds and fungi, are involved in oxidative / osmotic stress response and hydroperoxide detoxification. Interestingly, eukaryotic proteins from this family do not form a common sub-tree and appear to represents independent gene transfer events. In the vicinity of gene Ta0195, a death associated protein kinase related protein is found with score 0.8 (Ta0196)

    According to SCOP, 2onf and its structural similar neighbors (PDB structures [Dali Z score]: PDB:2pn2 [Z=15], PDB:1ml8 [Z=15], PDB:2d7v [Z=16], PDB:1n2f [Z=14], PDB:1qwi [Z=14], PDB:1vla [Z=12], and PDB:2opl [Z=11]) belong to the OsmC-like fold from the alpha+beta class. Other proteins from this family solved by JCSG are Thermotoga maritima protein TM0919 (PDB:1vla, topsan) and Psychrobacter arcticus protein Psyc_0566 (PDB:2pn2, topsan).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch