.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oik

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of histidine triad (HIT) protein (YP_546612.1) from Methylobacillus flagellatus KT at 1.65 A resolution. To be published
    Site JCSG
    PDB Id 2oik Target Id 371704
    Molecular Characteristics
    Source Methylobacillus flagellatus kt
    Alias Ids TPS1590,YP_546612.1, 103464 Molecular Weight 17590.48 Da.
    Residues 153 Isoelectric Point 7.78
    Sequence mtrtmsfhkncelcttaggeilwqdalcrvvhvenqdypgfcrvilnrhvkemsdlrpaerdhlmlvvf aveeavrevmrpdkinlaslgnmtphvhwhviprfkrdrhfpnsvwgetkreslpqaldqgsttalkka isvrldqgepvfmgm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.65 Rfree 0.223
    Matthews' coefficent 1.97 Rfactor 0.179
    Waters 462 Solvent Content 37.53

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2oik
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Fragile histidine triad protein: structure, function, and its association with tumorogenesis
    MI Hassan, A Naiyer, F Ahmad - Journal of cancer research and clinical , 2010 - Springer
     
    3. Disulfide conformation and design at helix N_termini
    S Indu, ST Kumar, S Thakurela, M Gupta - Proteins: Structure, , 2010 - Wiley Online Library
     

    Protein Summary

    The gene Mfla_2506 from Methylobacillus flagellatus encodes the YP_546612, a histidine triad  protein (HIT) from the group PF01230.  

    2oik belongs to the class of alpha and beta (a+b) proteins and adopts a HIT-like fold SCOP54196, inside the HIT family of protein kinase interacting proteins.  DALI top hits are with the HIT proteins like PDB:3i4s (Z=15), PDB:3lb5 (Z=13), PDB:1y23 (Z=12) and PDB:6fit (Z=12).

    The HIT motif H-x-H-x-H-x (HVHWHV) is highly conserved among HIT homologues.  On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases; the Fhit branch, that consists of diadenosine polyphosphate hydrolases; and the GalT branch consisting of specific nucloside monophosphate transferases. Fhit homologues are diadenosine polyphosphate hydrolases and function as tumour suppressors in human and mouse. GalT homologues transfer nucleoside monophosphate moieties to phosphorylated second substrates rather than hydrolysing them.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch