.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oh3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of COG1633: Uncharacterized conserved protein (ZP_00055496.1) from Magnetospirillum magnetotacticum MS-1 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 2oh3 Target Id 370399
    Molecular Characteristics
    Source Magnetospirillum magneticum amb-1
    Alias Ids TPS1563,MMAG_12JAN01_CONTIG3864_REVISED_GENE3092, 1.20.1260.10, 103218 Molecular Weight 19064.28 Da.
    Residues 166 Isoelectric Point 4.79
    Sequence mgytlaeflahaialeteaaeryveladmmeahnnldtatvfrdmarfstlhgdeikqrsralelpklm swqyrwktppevgdendihylmtpyhalryardneirgmeyykeaaansadpevkrlgadfaaeeaehv valdkwiektprpsitwsedadpaqcvd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.235
    Matthews' coefficent 2.79 Rfactor 0.192
    Waters 111 Solvent Content 55.93

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2oh3
    1. The Ferritin-like superfamily: Evolution of the biological iron storeman from a rubrerythrin-like ancestor
    SC Andrews - Biochimica et Biophysica Acta (BBA)-General Subjects, 2010 - Elsevier
     
    2. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    3. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Modeling the alternative oxidase from the human pathogen Blastocystis using automated hybrid structural template assembly
    DM Standley, M van der Giezen - Research and Reports in , 2012 - dovepress.com
     
    5. Functional, structural and evolutionary analyses of the ferritin-like superfamily of proteins
    RB Cooley - 2011 - scholarsarchive.library.oregonstate.
     

    Protein Summary

    ZP_00055496.1 from Magnetospirillum magnetotacticum encodes a 166 aa protein. The structure  of ZP_00055496.1 consists of a ferratin-like fold. Size exclusion chromatography and static light scattering indicate that the oligomeric state of ZP_00055496.1 is a dimer, though comparison with structurally similar proteins suggests it could be a tetramer. The location of the metal binding site is not consistent with either ferratins or rubrerythrin, therefore it is unclear what the function may be. Although residues 155-166 are disordered in the final model, they do not appear to be in a location that would comprise another metal binding site. Additionally, while other rubrerythrin structures contain N- and C-terminal domains, ZP_00055496.1 consists of only a single bundle.


    FJ9519A shown as a monomer (A), dimer (B) and tetramer (C), with the zinc ion in yellow. Structural alignment of FJ9519A with 1dsp (D).

    Ligand Summary

    Presence of zinc vs other metals is confirmed via excitation and MAD scans.

    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    370399_figure_1.png
    No description
    164.96 kB22:03, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch