.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oh1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of acetyltransferase GNAT family (YP_013287.1) from Listeria monocytogenes 4b F2365 at 1.46 A resolution. To be published
    Site JCSG
    PDB Id 2oh1 Target Id 371602
    Molecular Characteristics
    Source Listeria monocytogenes str. 4b f2365
    Alias Ids TPS1586,YP_013287.1, 91148 Molecular Weight 20475.38 Da.
    Residues 178 Isoelectric Point 5.43
    Sequence mnqnkitaggleflvrfaaptdrlkindlmidtarwlkesgstqwsdilhgfdvhnieqrielgevalf eteagalagamiirktpsdwdtdlwedlaidkayylhrimvsrafsgislskqmiyfaeklgiemsvpf irldciesnetlnqmyvrygfqfsgkkngfylyqkelsqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.46 Rfree 0.193
    Matthews' coefficent 2.41 Rfactor 0.168
    Waters 858 Solvent Content 48.94

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2oh1
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The gene YP_013287.1 from Listeria monocytogenes encodes an acetyltransferase, a member of the GCN5-related N-acetyltransferase (GNAT) superfamily of acetyltransferases PF00583.  The enzyme belongs to the class of alpha and beta (a+b) proteins and adopts an Acyl-CoA N-acyltransferases fold type SCOP55728.  The GNAT acetyltransferases are an enormous superfamily of enzymes that are universally distributed in nature and that use acyl-CoASH to acylate their cognate substrates. These include aminoglycoside N-acetyltransferases, serotonin N-acetyl-transferase, glucosamine-6-phosphate N-acetyltransferase, the histone acetyltransferases, mycothiol synthase, protein N-myristoyl-transferase, and the Fem family of amino acyl transferases. The first members of the GNAT superfamily were identified as aminoglycoside acetyltransferases in bacteria that became resistant to the action of the antibiotics gentamicin and kanamycin.  [Ref]

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch