| Title | Crystal structure of acetyltransferase GNAT family (YP_013287.1) from Listeria monocytogenes 4b F2365 at 1.46 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 371602 | | Molecular Characteristics | | Source | Listeria monocytogenes str. 4b f2365 | | Alias Ids | TPS1586,YP_013287.1 | Molecular Weight | 20475.38 Da. | | Residues | 178 | Isoelectric Point | 5.43 | | Sequence | mnqnkitaggleflvrfaaptdrlkindlmidtarwlkesgstqwsdilhgfdvhnieqrielgevalf eteagalagamiirktpsdwdtdlwedlaidkayylhrimvsrafsgislskqmiyfaeklgiemsvpf irldciesnetlnqmyvrygfqfsgkkngfylyqkelsqk | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 1.46 | Rfree | 0.193 | | Matthews' coefficent | 2.41 | Rfactor | 0.168 | | Waters | 858 | Solvent Content | 48.94 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The gene YP_013287.1 from Listeria monocytogenes encodes an acetyltransferase, a member of the GCN5-related N-acetyltransferase (GNAT) superfamily of acetyltransferases PF00583. The enzyme belongs to the class of alpha and beta (a+b) proteins and adopts an Acyl-CoA N-acyltransferases fold type SCOP55728. The GNAT acetyltransferases are an enormous superfamily of enzymes that are universally distributed in nature and that use acyl-CoASH to acylate their cognate substrates. These include aminoglycoside N-acetyltransferases, serotonin N-acetyl-transferase, glucosamine-6-phosphate N-acetyltransferase, the histone acetyltransferases, mycothiol synthase, protein N-myristoyl-transferase, and the Fem family of amino acyl transferases. The first members of the GNAT superfamily were identified as aminoglycoside acetyltransferases in bacteria that became resistant to the action of the antibiotics gentamicin and kanamycin. [Ref]
Ligand Summary
References
