The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of conserved hypothetical protein TIGR00488 (NP_688652.1) from Streptococcus agalactiae 2603 at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 2ogi Target Id 370306
    Molecular Characteristics
    Source Streptococcus agalactiae 2603v/r
    Alias Ids TPS1560,NP_688652.1, BIG_3, 91165 Molecular Weight 22316.19 Da.
    Residues 195 Isoelectric Point 5.55
    Sequence mtykdytgldrtellskvrhmmsdkrfnhvlgveraaielaerygydkekaglaallhdyakelsddef lrlidkyqpdpdlkkwgnniwhglvgiykiqedlaikdqdilaaiakhtvgsaqmstldkivyvadyie hnrdfpgveearelakvdlnkavayetartvaflaskaqpiypktietynayipyld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.229
    Matthews' coefficent 2.44 Rfactor 0.172
    Waters 272 Solvent Content 49.63

    Ligand Information


    Google Scholar output for 2ogi
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
    2. Structural and Biochemical Analysis of Nuclease Domain of Clustered Regularly Interspaced Short Palindromic Repeat (CRISPR)-associated Protein 3 (Cas3)
    S Mulepati, S Bailey - Journal of Biological Chemistry, 2011 - ASBMB
    3. Structure-based functional inference of hypothetical proteins from Mycoplasma hyopneumoniae
    MM Da Fonsca, A Zaha, ER Caffarena - Journal of Molecular , 2011 - Springer

    Protein Summary

    The SAG1661 of S. agalactiae 2603 encodes the NP_688652 protein, a putative metal dependent phosphohydrolase (PF01966) with very strong sequence similarity to COG1713 (predicted HD superfamily hydrolase involved in NAD metabolism). Analysis of its genome context indicates a likely functional link (score 0.89) with SAG1659, a Iojap-related protein, and SAG1665, a haloacid dehalogenase-like family hydrolase.

    2ogi structure belongs to SCOP all alpha class, HD-domain/PDEase-like superfamily, HD domain family. DALI top hits are with the BH1327 protein PDB:2o08 (Z=28), and the HD hydrolases PDB:3ccg (Z=27) and PDB:2pq7 (Z=11).

    Ligand Summary

    In the crystal structure SAG1661 interacts with guanosine-5'-diphosphate (GDP), MES and Fe and Cl. For details please see PDBsum server.





    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch