.
The Open Protein Structure Annotation Network
PDB Keyword
.

2od6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (JCVI_PEP_1096682647733) from an environmental metagenome (unidentified marine microbe), Sorcerer II Global Ocean Sampling experiment at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 2od6 Target Id 367441
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS1510,JCVI_PEP_1096682647733 Molecular Weight 12625.03 Da.
    Residues 109 Isoelectric Point 5.46
    Sequence maepkftsfttadfindvdmelfidavektapvwvkemksrgllkfsmnrvwnkgevfrvvmtyeykdr asfeaniayledtfgknpvflqlvttakfttsrclvvmev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.85 Rfree 0.231
    Matthews' coefficent 2.36 Rfactor 0.197
    Waters 304 Solvent Content 47.89

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2od6
    1. Probing metagenomics by rapid cluster analysis of very large datasets
    W Li, JC Wooley, A Godzik - PLoS One, 2008 - dx.plos.org
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    3. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     

    Protein Summary

    The gene ID JCVI_PEP_1096682647733 from an unidentified marine microbe encodes a protein of unknown function. The fold type for its structure (2od6) is assigned as a ferredoxin-like SCOP54861.  However, no significant sequence similarity can be detected with known ferredoxin-like proteins.  

    According to DALI, 2od6 has significant structural similarity with 2op5 (Z-scr=15), 1vqy (Z-scr=11) and the heme degrading protein from M. tuberculosis 3hx9 [Ref] (Z-scr=11). Structurally, 2od6 is rather similar to the C-terminal domain of the aminotransferase-like enzyme 3HT5 (?).

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch