.
The Open Protein Structure Annotation Network
PDB Keyword
.

2obp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative DNA-binding protein (YP_298295.1) from Ralstonia eutropha JMP134 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 2obp Target Id 370563
    Molecular Characteristics
    Source Ralstonia eutropha jmp134
    Alias Ids TPS1573,YP_298295.1, 92385 Molecular Weight 9942.71 Da.
    Residues 95 Isoelectric Point 4.57
    Sequence msdpgneqngdgidpaivevllvlreagiengatpwslpkiakraqlpmsvlrrvltqlqaagladvsv eadgrghasltqegaalaaqlfpdpf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.219
    Matthews' coefficent 2.89 Rfactor 0.186
    Waters 166 Solvent Content 57.38

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2obp
    1. Enzyme adaptation to inhibitor binding: A cryptic binding site in phenylethanolamine N-methyltransferase
    CL Gee, N Drinkwater, JDA Tyndall - Journal of medicinal , 2007 - ACS Publications
     
    2. Structure of the Archaeoglobus fulgidus orphan ORF AF1382 determined by sulfur SAD from a moderately diffracting crystal
    JY Zhu, ZQ Fu, L Chen, H Xu, J Chrzas - Section D: Biological , 2012 - scripts.iucr.org
     

    Protein Summary

    The Reut_B4095 gene from Ralstonia eutropha jmp134 encodes the YP_298295 protein, a member of the Rrf2 family of transcription regulators (e-val=0.0003) (PF02082). It has sequence similarity to the transcriptional regulator group (COG1339). The homolog gene in R. eutropha H16 strain is predicted to have a functional link by neighborhood association (score 0.87) with a transcriptional regulator of the MocR family.

    2obp structure belongs to the SCOP "winged-helix" superfamily and shows structural similarity to other transcription regulators of the same fold (e.g. DALI Z-score 12.9, rmsd 1.8 Å over 78 residues, 17% identity with PDB id: 2QVO; DALI Z-score 11.8, rmsd 2.0 Å over 73 residues, 27% identity with PDB id: 3CJN, a transcriptional regulator of the MarR family).

    Both homology and structural similarity suggest the protein may function, like MarR, as part of a resistance system.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch