.
The Open Protein Structure Annotation Network
PDB Keyword
.

2obn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Protein of unknown function DUF1611 (YP_324013.1) from Anabaena variabilis ATCC 29413 at 2.30 A resolution. To be published
    Site JCSG
    PDB Id 2obn Target Id 370701
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS1575,YP_324013.1, PF07755 Molecular Weight 36993.79 Da.
    Residues 348 Isoelectric Point 6.55
    Sequence mrlplnqrvaillhegttgtigktglallryseapivavidrncagqslreitgikrdvpivksveaal eykpqvlvigiapkgggipddywielktalqagmslvnglhtplanipdlnallqpgqliwdvrkepan ldvasgaartlpcrrvltvgtdmaigkmstslelhwaaklrgwrskflatgqtgvmlegdgvaldavrv dfaagaveqmvmrygknydilhiegqgsllhpgstatlplirgsqptqlvlvhragqthngnnphvpip plpevirlyetvasgggafgtvpvvgialntahldeyaakeaiahtiaetglpctdvvrfgadvlldavmqn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.214
    Matthews' coefficent 2.25 Rfactor 0.175
    Waters 521 Solvent Content 45.39

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2obn
    1. Detection of Functionally Important Regions in
    G Nimrod, M Schushan, DM Steinberg, N Ben-Tal - Structure, 2008 - Elsevier
     
    2. Foldamers: Accomplishments and Goals
    SH Gellman - 2010 - iecb.u-bordeaux.fr
     

    Protein Summary

    The Ava_3511 gene from Anabaena variabilis atcc 29413 encodes the YP_324013 protein with sequence similarity to the DUF1611 (PF07755, COG3367). PSI-BLAST aligns Ava_3511 with the C-terminal region of the muconate cycloisomerase (ZP_05044433) with an e-val=1e-87, seq.id. 53%, gaps 1%. Analysis of its genome context indicates a likely functional link (score 0.99) with its neighbor Ava_3512, a muconate lactonizing enzyme.

    2obn structure belongs to the alpha/beta class and adopts a P-loop containing nucleoside triphosphate hydrolase fold, inside the same named superfamily, nitrogenase iron protein-like family. According to DALI, 2obn shows significant similarity to another homolog structure determined by structural genomics (PDB id: PDB:2g0t DALI Z-score 35.8, rmsd 2.5 Å over 316 residues, sequence identity 33%). Next is the nucleotide binding protein PDB:3kb1 (Z=14).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch