The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of BH2720 (10175341) from Bacillus halodurans at 1.41 A resolution. To be published
    Site JCSG
    PDB Id 2oa2 Target Id 371834
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1597,10175341, 1.20.1260.10,, 396424 Molecular Weight 16960.16 Da.
    Residues 147 Isoelectric Point 5.97
    Sequence slheeadhrvtdhgprpfvvniedetkrnrafrralwtgdhlqvtlmsiqvgedigleihphldqflrv eegrglvqmghrqdnlhfqeevfddyailipagtwhnvrntgnrplklysiyappqhphgtvhetkaia maaeehhhl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.41 Rfree 0.189
    Matthews' coefficent 2.06 Rfactor 0.165
    Waters 143 Solvent Content 40.20

    Ligand Information


    Google Scholar output for 2oa2
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
    2. Conformational changes associated with the binding of zinc acetate at the putative active site of XcTcmJ, a cupin from Xanthomonas campestris pv. campestris
    HL Axelrod, P Kozbial, D McMullan - Section F: Structural , 2009 - scripts.iucr.org

    Protein Summary

    Gene BH2720 from Bacillus halodurans encodes the NP_243586 protein that belongs to the cupin2 group (PF07883). 2oa2 has FATCAT top hit to SCOP superfamily of RmlC-like cupins [51182] (1v70A with score 240.82). DALI top hits for 2oa2 are with the tetracenomycin polyketide synthesis protein (PDB: 2gu9-A ; Z-score 13.9; RMSD 1.9), a novel manganese-containing cupin (PDB: 1vj2-A ; Z-score 11.9; RMSD 2.6) and other members of superfamily of RmlC-like cupins.


    It has functional associations (predicted with string.embl.de) with: BH3827 protein, BH0338 protein, BH2721 protein, BH2719 (YvaM), BH0337, BH2722, and Cell wall hydrolase cwlJ.

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch