.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o8q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (YP_555756.1) from Burkholderia xenovorans LB400 at 1.55 A resolution. To be published
    Site JCSG
    PDB Id 2o8q Target Id 369680
    Molecular Characteristics
    Source Burkholderia xenovorans lb400
    Alias Ids TPS1549,YP_555756.1, 2.60.120.10, 103354 Molecular Weight 14871.98 Da.
    Residues 133 Isoelectric Point 5.31
    Sequence mklqttiqhepkdgsgfdrglreffeyrdtgvneatggmfgahviraipgkeakptwhthtvgfqlfyv lrgwvefeyedigavmleaggsafqppgvrhrelrhsddlevleivspagfatsvvdleearkp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.191
    Matthews' coefficent 3.24 Rfactor 0.17
    Waters 231 Solvent Content 61.98

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2o8q
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Homology modeling and function prediction of hABH1, involving in repair of alkylation damaged DNA
    S Das, AS Vidyarthi - Interdisciplinary Sciences: Computational Life , 2011 - Springer
     

    Protein Summary

    The Bxe_C0505 gene (PF07883, cl09118) from Burkholderia xenovorans encodes for a protein from the cupin superfamily. The structure adopts a double stranded beta belix. Currently, the most similar structure is 1gqg (sharing 87 structurally equivalent residues with a rmsd of 1.45A (TopMatch)), a metal dependent deoxygenase belonging to the SCOP superfamily of RmlC-like cupins (SCOP) from Aspergillus japonicus [Ref]. A run against HHpred PFAM families gives several top scoring hits from the EC:5.3.1.- class of enzymes, contradicting the EC:1.13.11.24 number of 1gqg. A highly similar structure determined by PSI is 2h0v.

    ToDo: Check the binding sites of Cu (1gqg) and Ni. Find out more about the active site.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch