.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o7t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of transcriptional regulator (NP_600854.1) from Corynebacterium glutamicum ATCC 13032 Kitasato at 2.10 A resolution. To be published
    Site JCSG
    PDB Id 2o7t Target Id 370229
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS1556,NP_600854.1, 103318 Molecular Weight 21785.67 Da.
    Residues 198 Isoelectric Point 6.18
    Sequence mradalkrrehiitttcnlyrthhhdsltmeniaeqagvgvatlyrnfpdrftldmacaqylfnvvisl qlqaistfptdpegvwtsfnqllfdrglgslvpalapeslddlpdevsalrrttekntttlinlakqhg lvhhdiapgtyivglitisrppitalatisenshkallglylsglkhgmmanigehdgks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.23
    Matthews' coefficent 2.22 Rfactor 0.18
    Waters 72 Solvent Content 44.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2o7t
    1. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    2. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     

    Protein Summary

    Gene Cgl1640 from Corynebacterium glutamicum atcc 13032 kitasato encodes the NP_600854 protein that has sequence similarity to the COG1309 (AcrR transcriptional regulator) and PF00440 (tetR family) groups.

    SCOP classifies 2o7t in the all alpha class, with the N-terminal domain (1-78) in the homeodomain-like superfamily, tetracyclin receptor-like N-terminal domain family; and the C-terminal domain (79-188) in the tetracyclin repressor-like C-terminal domain (super)family. DALI top hits are with transcriptional repressors like 2v57 (Z=15), 2qtq (Z=15), 2rek (Z=14), 1vio (Z=13), 1t56 (Z=12).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch