.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o62

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (ZP_00105914.2) from Nostoc punctiforme PCC 73102 at 1.75 A resolution. To be published
    Site JCSG
    PDB Id 2o62 Target Id 369000
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS1543,NPUN_22DEC03_CONTIG1_REVISED_GENENPR4044, 92466 Molecular Weight 30268.74 Da.
    Residues 269 Isoelectric Point 5.38
    Sequence mksqwecflqnlgvwegsfsnfspegtllndtssrlcleglnnnqtvrltlsrsgkddvirefrsvggg llffengsfsegliqlgpfsefggelafvhenrrlrlvqlfdrnghlngltlirehlagtpvaerpllq indllgewrgqavtiyrdlrppdiysttlkiqlddagrlmqstsfgertitstatikgsivlfdqdpek qvqvlllpdgasatsplkvqlrqplfleagwliqsdlrqrmirsyndkgewvsltlvteerv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.208
    Matthews' coefficent 2.39 Rfactor 0.166
    Waters 506 Solvent Content 48.55

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2o62
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    Gene Npun_R4044 from Nostoc punctiforme pcc 73102 encodes the YP_001867366 protein that belongs to the DUF3598 (PF12204). Genome context analysis provides no significant hits.

    2o62 structure forms an homodimer. Each chain consists of two repeats (~30% sequence identity between repeats) of a ten stranded meander beta sheet fold (SCOP: all beta class, lipocalin superfamily, All1756-like family). Despite low sequence similarity (~9% sequence ID), barely recognizable by profile-profile alignment (FFAS Z-score of -8.1), each of the domains is very similar to the structure of the Arabidopsis thaliana protein 2a13 (DALI Z-score 12.8, RMSD 3.1 on 130 residues) and Mycobacterium tuberculosis protein 2fr2(Z=13). Even more distant similarity to human fatty acid binding protein (PDB 1hmt, DALI Z-score 10, RMSD 2.9; SCOP superfamily: Lipocalins) provide possible clues as to its function.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch