.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o4t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of BH3976 (10176601) from Bacillus halodurans at 1.95 A resolution. To be published
    Site JCSG
    PDB Id 2o4t Target Id 372074
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1601,10176601, PF06304 Molecular Weight 10910.89 Da.
    Residues 99 Isoelectric Point 4.94
    Sequence ahvsrveklpkdyqivykeiqkylfkvgpvelnegigllseilgffeegaaagkgvldvtgtdvaafcd aligdsktyadlyqesiqqhvdkamknmkd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.255
    Matthews' coefficent 3.33 Rfactor 0.203
    Waters 56 Solvent Content 63.02

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2o4t
    1. On the combination of molecular replacement and single-wavelength anomalous diffraction phasing for automated structure determination
    S Panjikar, V Parthasarathy, VS Lamzin - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    Gene BH3976 from Bacillus halodurans encodes the NP_244844 protein that belongs to the DUF1048 group (PF06304) inside the Yip1 clan; similar structures are annotated as membrane proteins. It has predicted (string.embl.de) functional associations with genomic neighbors: BH3977 protein, BH3978 (ABC transporter), and BH3979 (ABC transporter).

    SCOP classifies 2o4t in the all alpha class, left-handed superhelix fold, BH3980-like (super)family. DALI top hits are with the hypothetical protein 2o3l (Zscr=11) and the BH3980 protein 2hh6 (Z=11). Weaker hits are with the carboxyl-terminal domain (CTD) binding of the SET2 SRI domain that couples histone H3 Lys36 methylation to transcription (PDB: 2c5z; Z-score 5.2; RMSD 3.9), and a protein of unknown function (PDB: 2ffj, Z-score 5.0; RMSD 2.6).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch