.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o3l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_979748.1) from Bacillus cereus ATCC 10987 at 2.05 A resolution. To be published
    Site JCSG
    PDB Id 2o3l Target Id 372072
    Molecular Characteristics
    Source Bacillus cereus atcc 10987
    Alias Ids TPS1600,NP_979748.1, PF06304 Molecular Weight 9550.41 Da.
    Residues 84 Isoelectric Point 4.49
    Sequence eykmmmarvaalpedyqfvfkkiqnymwnfsagngmdmlhiqyelidlfeagaaegrqvlditgedvas fadelvanaktyvsk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.227
    Matthews' coefficent 2.78 Rfactor 0.184
    Waters 106 Solvent Content 55.71

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2o3l
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Molecular replacement using ab initio polyalanine models generated with ROSETTA
    DJ Rigden, RM Keegan, MD Winn - Acta Crystallographica Section D , 2008 - scripts.iucr.org
     
    3. EDM-DEDM and protein crystal structure solution
    R Caliandro, B Carrozzini, GL Cascarano - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    Gene BCE_3448 from Bacillus cereus atcc 10987 encodes the NP_979748 protein with sequence similarity to the DUF1048 (PF06304). Remotely similar sequences are annotated as ferritin-like DNA-binding.

    SCOP classifies 2o3l in the all alpha class, left handed superhelix fold, BH3980-like (super)family. 2o3l has DALI top hits with the BH3980 protein PDB:2hh6 (Z=11), and the BH3976 protein PDB:2o4t (Z=11); a low scored hit is obtained with the siroheme biosynthesis protein Met8 1kyq (Z=5).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch