.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o2g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Dienelactone hydrolase (YP_324580.1) from Anabaena variabilis ATCC 29413 at 1.92 A resolution. To be published
    Site JCSG
    PDB Id 2o2g Target Id 370216
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS1555,YP_324580.1, 103338 Molecular Weight 23988.08 Da.
    Residues 222 Isoelectric Point 6.05
    Sequence mdrtlthqpqeyavsvsvgevklkgnlvipngatgivlfahgsgssrysprnryvaevlqqaglatlli dlltqeeeeidlrtrhlrfdigllasrlvgatdwlthnpdtqhlkvgyfgastgggaalvaaaerpetv qavvsrggrpdlapsalphvkaptllivggydlpviamnedaleqlqtskrlviiprashlfeepgalt avaqlasewfmhylr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.92 Rfree 0.238
    Matthews' coefficent 2.10 Rfactor 0.183
    Waters 168 Solvent Content 41.41

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2o2g
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Certain heptapeptide and large sequences representing an entire helix, strand or coil conformation in proteins are associated as chameleon sequences
    N Krishna, K Guruprasad - International Journal of Biological , 2011 - Elsevier
     
    3. Functional and structural studies of a novel cold-adapted esterase from an Arctic intertidal metagenomic library
    J Fu, HKS Leiros, D de Pascale, KA Johnson - Applied Microbiology , 2012 - Springer
     
    4. Why inverse proteins are relatively abundant
    JC Nebel - Protein and peptide , 2010 - ingentaconnect.com
     
    5. Automatch: Target_binding protein design and enzyme design by automatic pinpointing potential active sites in available protein scaffolds
    C Zhang, L Lai - Proteins: Structure, Function, and , 2011 - Wiley Online Library
     

    Protein Summary

    The Ava_4081 gene encodes the YP_324580.1 amino acid sequence which belongs to dienelactone hydrolase group (PF01738) and related enzymes (COG0412). DALI top hits are with several alpha/beta hydrolases like 2fuk (Z-score 22.8; RMSD 2.4) and  the 322-581 C-terminal fragment of 1ve6 (Z-score 22.7; RMSD 2.4; note that 1ve6 has two SCOP domains).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch