.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o1q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative acetyl/propionyl-CoA carboxylase, alpha subunit (ZP_00243239.1) from Rubrivivax gelatinosus PM1 (Methylobium petroleophilum PM1) at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 2o1q Target Id 370490
    Molecular Characteristics
    Source Methylibium petroleiphilum pm1
    Alias Ids TPS1567,YP_001022847.1, 2.60.120.10, 103277 Molecular Weight 15546.82 Da.
    Residues 144 Isoelectric Point 5.75
    Sequence mlkskikeeyvqmdqvdwkpfpaafstggirwkllhvspemgswtaifdcpagssfaahvhvgpgeyfl tkgkmdvrggkaaggdtaiapgygyesanarhdktefpvasefymsflgpltfvkpdgspiavigweda qgawaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.21
    Matthews' coefficent 2.03 Rfactor 0.181
    Waters 206 Solvent Content 39.33

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene Mpe_A3659 from Methylobium petroleophilum pm1 encodes the YP_001022847 protein, the alpha subunit of a putative acetyl/propionyl-CoA carboxylase. Similar proteins are annotated as acetylacetone-cleaving enzymes. 2o1q belongs to the SCOP cupin superfamily, acetylacetone cleaving enzyme-like family. It has DALI top hits with structures from the SCOP superfamily RmlC-like cupins (PDB: 1vj2; Z-score 12.3, RMSD 2.6).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch