.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o08

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_242193.1) from Bacillus halodurans at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 2o08 Target Id 367737
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1524,NP_242193.1, BIG_3, 86280 Molecular Weight 21519.60 Da.
    Residues 187 Isoelectric Point 6.31
    Sequence mnrgkalqlvkphltehryqhtigvmetaidlaklygadqqkaelaaifhdyakfrdknemrtlirekl sqqdilfygdellhapcgayyvreevgiededvlqairfhttgrpnmsllekiifladyiepnrqfpgv ekvrtqaktdlngaiisslvntitfllkknqpiypdtlatynqllleqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.223
    Matthews' coefficent 3.04 Rfactor 0.174
    Waters 325 Solvent Content 59.58

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2o08
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Structural and Biochemical Analysis of Nuclease Domain of Clustered Regularly Interspaced Short Palindromic Repeat (CRISPR)-associated Protein 3 (Cas3)
    S Mulepati, S Bailey - Journal of Biological Chemistry, 2011 - ASBMB
     
    3. Structure-based functional inference of hypothetical proteins from Mycoplasma hyopneumoniae
    MM Da Fonsca, A Zaha, ER Caffarena - Journal of Molecular , 2011 - Springer
     

    Protein Summary

    Gene BH1327 from Bacillus halodurans encodes the NP_242193 protein that has sequence similarity to predicted HD superfamily hydrolases (PF01966) involved in NAD metabolism (COG1713). Predicted functional associations (string.embl.de) are with: nadD (Probable nicotinate-nucleotide adenylyltransferase), BH1325, BH1328, BH1323, aroD (Shikimate dehydrogenase), BH1322, BH1330, BH1329, BH1213, and UPF0348.

    PreSCOP classifies 2o08 in the all alpha class, HD-domain like (super)family.

    2o08 DALI top hits are with: exopolyphosphatase (PDB: 1u6z; Z-score 8.9; RMSD 4.0) and to PDB: 2hek (Z-score 8.0; RMSD 3.8).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch