The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Site-specific recombination of nitrogen-fixation genes in cyanobacteria by XisF-XisH-XisI complex: Structures and models. Proteins 2014
    Site JCSG
    PDB Id 2nvm Target Id 367675
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS1519,YP_321976.1, BIG_57, BIG_402, 86332 Molecular Weight 14423.69 Da.
    Residues 125 Isoelectric Point 5.23
    Sequence mdklthyrhtiqeiikkyydlsnsqpatatetkisddlpdtvgdrliideqrdqylwlccgwdgkkrvq hiilylqiqngkiwieedstnlaivdemlvagipqtdiilgfhhpskrgltefaia
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.19 Rfree 0.244
    Matthews' coefficent 2.86 Rfactor 0.201
    Waters 57 Solvent Content 56.94

    Ligand Information



    Protein Summary

    YP_321976 (locus name: Ava_1458) from A. variabilis ATCC 29413 encodes protein annotated as fdxN element excision controlling factor XisI (PMID: 9106215). YP_321976 is present in cyanobacteria and one species of chloroflexi (green non-sulfur bacteria).

    It has strong structural similarity to PDB structure 2nlv.

    Analysis of the crystallographic packing of YP_321976 using the PQS server {Henrick, 1998 #73} indicates that a tetramer is the biologically relevant form.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch