.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kzc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the protein YP_510488.1. To be Published
    Site JCSG
    PDB Id 2kzc Target Id 387115
    Molecular Characteristics
    Source Jannaschia sp. ccs1
    Alias Ids TPS7488,YP_510488.1, PF07345, 89105 Molecular Weight 9296.16 Da.
    Residues 84 Isoelectric Point 4.99
    Sequence mqfkaearrnklmglwvaevlgksgdeanayaaevvkadfeeaghedvmrkvlgdldgkrpeaevraky eglmavakaqlmdel
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kzc
    1. The J-UNIO protocol for automated protein structure determination by NMR in solution
    P Serrano, B Pedrini, B Mohanty, M Geralt - Journal of biomolecular , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch