.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jzf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Nuclear magnetic resonance structure shows that the severe acute respiratory syndrome coronavirus-unique domain contains a macrodomain fold. J.Virol. 83 1823-1836 2009
    Site JCSG
    PDB Id 2jzf Target Id 388820
    Related PDB Ids 2rnk 
    Molecular Characteristics
    Source Sars coronavirus tor2
    Alias Ids TPS1780,29837497 Molecular Weight 15428.09 Da.
    Residues 139 Isoelectric Point 7.93
    Sequence vlpseapnakeeilgtvswnlremlahaeetrklmpicmdvraimatiqrkykgikiqegivdygvrff fytskepvasiitklnslneplvtmpigyvthgfnleeaarcmrslkapavvsvsspdavttyngyltss
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    This amino acid sequence from Sars coronavirus forms the central segment of the SARS-unique domain (SUD-M, for "middle of the SARS-unique domain") in the nonstructural protein Nsp3 PF11633.  SUD-M(513-651) exhibits a macrodomain fold containing the Nsp3 residues 528 to 648, and there is a flexibly extended N-terminal tail with the residues 513 to 527 and a C-terminal flexible tail of residues 649 to 651.  NMR chemical shift perturbation experiments showed that SUD-M(527-651) binds single-stranded poly(A) RNA.  SUD-M(527-651) has the closest three-dimensional structure homology with another domain of Nsp3, the ADP-ribose-1"-phosphatase Nsp3b, although the two proteins share only 5% sequence identity in the homologous sequence regions. SUD-M(527-651) also shows three-dimensional structure homology with several helicases and nucleoside triphosphate-binding proteins, but it does not contain the motifs of catalytic residues found in these structural homologues [Ref].  The Nudix fold type classification SCOP55811 is in agreement with these observations, suggesting Nudix hydrolase-like functionality.  Nudix hydrolases are found in all classes of organisms and hydrolyse a wide range of organic pyrophosphates, including nucleoside di- and triphosphates, dinucleoside and diphosphoinositol polyphosphates, nucleotide sugars and RNA caps, with varying degrees of substrate specificity [Ref]. See 2rnk entry for further details.

    Ligand Summary



    References

    Reviews

    References

     

    1. Chatterjee A, Johnson MA, Serrano P, Pedrini B, Joseph JS, Neuman BW, Saikatendu K, Buchmeier MJ, Kuhn P, and W眉thrich K Nuclear magnetic resonance structure shows that the severe acute respiratory syndrome coronavirus-unique domain contains a macrodomain fold. J Virol. 2009 Feb; 83(4):1823-36 PubMed HubMed doi:10.1128/JVI.01781-08 pmid:19052085.

       


      Discuss this publication
    2. McLennan AG The Nudix hydrolase superfamily. Cell Mol Life Sci. 2006 Jan; 63(2):123-43 PubMed HubMed doi:10.1007/s00018-005-5386-7 pmid:16378245.

       


      Discuss this publication
    Tag page

    Files (2)

    FileSizeDateAttached by 
     2jwi.png
    No description
    9.98 kB19:21, 30 Jun 2008dweekesActions
     2jwj.png
    No description
    20.19 kB19:21, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch