.
The Open Protein Structure Annotation Network
PDB Keyword
.

2it9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (YP_292156.1) from Prochlorococcus sp. NATL2A at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 2it9 Target Id 368256
    Molecular Characteristics
    Source Prochlorococcus marinus str. natl2a
    Alias Ids TPS1538,PROC_21JUN05_CONTIG39_REVISED_GENEPMN12A0962, BIG_37 Molecular Weight 14707.05 Da.
    Residues 126 Isoelectric Point 4.77
    Sequence vikkegpgwriifdssrdnfstliggetwaieldksewkilvevvmelcdqyklvkeqlmgdeditlel errpwlailngdqygwnlrlilsasglfnrgaevywprhvtnnvvnamrsmwdsdyl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.213
    Matthews' coefficent 2.50 Rfactor 0.179
    Waters 386 Solvent Content 50.78

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2it9
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. X-ray structure of Pur-_ reveals a Whirly-like fold and an unusual nucleic-acid binding surface
    A Graebsch, S Roche - Proceedings of the , 2009 - National Acad Sciences
     

    Protein Summary

    YP_292156 from Prochlorococcus sp. NATL2A and its homologs are bacterial proteins with unknown function from a PFAM family PF08848 (DUF1818) with a ssDNA-binding transcriptional regulator domain fold, consisting of a repeat of two beta(4)-alpha motifs.

    YP_400729 has strong sequence and structure similarity to another JCSG solved protein, 2nvn.

    The most conserved residues are closely located in the protein structure: Trp9, Trp29, and Trp105 (Trp29 is part of ligand -PGE - from solvent binding cleft). 

    Other less conserved residues are: Asp14, Phe20, Leu23, Ile24, Gly25, Glu32, Glu37, Leu41, Leu48, Leu59, Met60, Glu63, Gly80, Trp85, Leu87, Leu91, Arg99, Glu102, Pro106.

    YP_292156 has significant structural similarity to other proteins from the ssDNA fold, including MRP2 (mitochondrial RNA-binding protein 2; PDB structure 2gia, DALI Z-score 4.5; RMSD 3.1; 5% sequence identity for 79 superimposed residues).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch